PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim09g025310.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 271aa    MW: 31368.2 Da    PI: 5.3867
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim09g025310.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM157.84.4e-49101381129
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrF P+deelv++yL kk++++++    ++ e+d++++ePw+Lp+ +k +++ewyfFs rd+kyatg r+nrat sgyWkatgkd++
  Sopim09g025310.0.1  10 LPPGFRFYPSDEELVCHYLFKKIANEDVLK-GTLIEIDLHTCEPWQLPEVAKLNSSEWYFFSFRDRKYATGFRTNRATISGYWKATGKDRT 99 
                         79************************9655.6799*************87788899*********************************** PP

                 NAM  92 vlsk.kgelvglkktLvfykgrapkgektdWvmheyrle 129
                         v++  +++ vg++ktLvfy +rap+g kt W+mhe+rle
  Sopim09g025310.0.1 100 VVDPkTRSIVGMRKTLVFYMNRAPNGIKTGWIMHEFRLE 138
                         **9856677***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.71E-608156IPR003441NAC domain
PROSITE profilePS5100557.20810156IPR003441NAC domain
PfamPF023655.4E-2711137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MGLRDIGATL PPGFRFYPSD EELVCHYLFK KIANEDVLKG TLIEIDLHTC EPWQLPEVAK  60
LNSSEWYFFS FRDRKYATGF RTNRATISGY WKATGKDRTV VDPKTRSIVG MRKTLVFYMN  120
RAPNGIKTGW IMHEFRLENP HIPPKEDWVL CRVFYKAKVE NNNNNDNNNT FSNTQNMYEV  180
GVNTSPNIDQ SHIALPYTAI SQSQKLFDLL EPNNNQSSYL QLMSQEMKEP QSNDEMVEND  240
EYGFLLDMNF EDPNIQDGSR SAFEHWGHVI *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-48915616165NO APICAL MERISTEM PROTEIN
1ut4_B2e-48915616165NO APICAL MERISTEM PROTEIN
1ut7_A2e-48915616165NO APICAL MERISTEM PROTEIN
1ut7_B2e-48915616165NO APICAL MERISTEM PROTEIN
4dul_A2e-48915616165NAC domain-containing protein 19
4dul_B2e-48915616165NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by auxin.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755210.0HG975521.1 Solanum lycopersicum chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004246952.10.0NAC domain-containing protein 21/22
SwissprotQ84TE63e-62NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLA0A3Q7HZV20.0A0A3Q7HZV2_SOLLC; Uncharacterized protein
STRINGSolyc09g025310.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18822466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.17e-93NAC domain containing protein 74
Publications ? help Back to Top
  1. Le Hénanff G, et al.
    Grapevine NAC1 transcription factor as a convergent node in developmental processes, abiotic stresses, and necrotrophic/biotrophic pathogen tolerance.
    J. Exp. Bot., 2013. 64(16): p. 4877-93
    [PMID:24043850]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  4. Huo X,Wang C,Teng Y,Liu X
    Identification of miRNAs associated with dark-induced senescence in Arabidopsis.
    BMC Plant Biol., 2015. 15: p. 266
    [PMID:26530097]
  5. Chen X, et al.
    Auxin-Independent NAC Pathway Acts in Response to Explant-Specific Wounding and Promotes Root Tip Emergence during de Novo Root Organogenesis in Arabidopsis.
    Plant Physiol., 2016. 170(4): p. 2136-45
    [PMID:26850273]
  6. Liu C,Wang B,Li Z,Peng Z,Zhang J
    TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth.
    Plant Physiol., 2018. 176(1): p. 742-756
    [PMID:29122985]