PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim08g068760.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRF
Protein Properties Length: 156aa    MW: 17395.8 Da    PI: 8.7185
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim08g068760.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC59.17.2e-19106139235
                 WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrg 35 
                          epgrC+RtDGK WRCsr+v + kk CE+H+hrg
  Sopim08g068760.0.1 106 LEPGRCKRTDGKNWRCSRDVAPHKKSCEHHMHRG 139
                         69*******************************8 PP

2QLQ483.9e-174781236
                 QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                        +FT+aQ+ +L +Q+++yKy+++ + vPp+Ll+ i+
  Sopim08g068760.0.1 47 PFTWAQWKELDRQAMIYKYMVSAMSVPPDLLLSIF 81
                        9********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.2E-94682IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.1E-114781IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166619.0354782IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166719.026105151IPR014977WRC domain
PfamPF088793.1E-15107139IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
MENSKNCYTI CSTDEANLLP LPPSTAVVRS FDVATNSQGM ATALGYPFTW AQWKELDRQA  60
MIYKYMVSAM SVPPDLLLSI FSGASHTTSA TGSVQGQRYT TNIRDLEPGR CKRTDGKNWR  120
CSRDVAPHKK SCEHHMHRGL SILKDGNLIQ VYIYF*
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a role in the regulation of cell expansion in leaf and cotyledons tissues. Component of a network formed by miR396, the GRFs and their interacting factors (GIFs) acting in the regulation of meristem function, at least partially through the control of cell proliferation. {ECO:0000250}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: microRNA 396 (miR396a or miR396b) negatively regulates growth-regulating factors (GRF1-4 and GRF7-9). {ECO:0000269|PubMed:15200956, ECO:0000269|PubMed:19453503, ECO:0000269|PubMed:20023165}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0109400.0AP010940.1 Solanum lycopersicum DNA, chromosome 8, clone: C08HBa0195L01, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015068264.16e-79growth-regulating factor 3-like isoform X1
RefseqXP_027771148.16e-79growth-regulating factor 3-like isoform X2
SwissprotQ9FJB83e-26GRF7_ARATH; Growth-regulating factor 7
TrEMBLA0A3Q7ILA51e-115A0A3Q7ILA5_SOLLC; Uncharacterized protein
STRINGSolyc08g068760.1.11e-115(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA70322230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.12e-26growth-regulating factor 7
Publications ? help Back to Top
  1. Cao Y,Han Y,Jin Q,Lin Y,Cai Y
    Comparative Genomic Analysis of the GRF Genes in Chinese Pear (Pyrus bretschneideri Rehd), Poplar (Populous), Grape (Vitis vinifera), Arabidopsis and Rice (Oryza sativa).
    Front Plant Sci, 2016. 7: p. 1750
    [PMID:27933074]