PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim07g065580.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NF-YB
Protein Properties Length: 179aa    MW: 20310.3 Da    PI: 9.6055
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim07g065580.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB91.21e-2819106794
               NF-YB   7 flPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 
                          lP+an++rim+ +lP+naki + +ke++q+  s +i  +t++a ++c+ e+rkt++++d+lwa+ ++G+  ++  l +yl++y e +
  Sopim07g065580.0.1  19 QLPMANLTRIMRGILPTNAKINDGSKESMQKLGSYYINRITKKAKERCNMERRKTVTAEDILWAMINMGLTIHARLLAQYLNRYHEYN 106
                         79**********************************************************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.0E-2717108IPR009072Histone-fold
SuperFamilySSF471131.07E-2218107IPR009072Histone-fold
PfamPF008081.4E-171983IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MTNVNTGVDQ LARRLLEVQL PMANLTRIMR GILPTNAKIN DGSKESMQKL GSYYINRITK  60
KAKERCNMER RKTVTAEDIL WAMINMGLTI HARLLAQYLN RYHEYNSVSY YNVRKPHPNE  120
PIPGYPYPHF PPNVLFYDPV TAALVTSRDF EMAAENDGSP SEASTSIVMP AYPFRQLG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B3e-2220104892Transcription factor HapC (Eurofung)
4g92_B3e-2220104892Transcription factor HapC (Eurofung)
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755190.0HG975519.1 Solanum lycopersicum chromosome ch07, complete genome.
GenBankAC2103450.0AC210345.1 Solanum lycopersicum cultivar Heinz 1706 chromosome 7 clone C07HBa0001N06, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010324259.11e-132PREDICTED: transcriptional activator hap3-like isoform X3
TrEMBLK4CHN61e-132K4CHN6_SOLLC; Uncharacterized protein
STRINGSolyc07g065580.1.11e-131(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14746510
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.28e-28nuclear factor Y, subunit B6