PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim06g073920.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family YABBY
Protein Properties Length: 193aa    MW: 21347.1 Da    PI: 8.6049
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim06g073920.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY2321.4e-7191654170
               YABBY   4 fssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesast 94 
                          ssse+vCyv+CnfC+tilavsvP +s++++vtvrCGhC++llsvn+a + q l+ ++ l+++ + ++ + +       + + ++++s+++
  Sopim06g073920.0.1   9 SSSSERVCYVHCNFCSTILAVSVPCNSMMTIVTVRCGHCANLLSVNIAPSLQSLPIQD-LQRQNESSIEDGM------SRGYGSSSSSTNS 92 
                         5799****************************************************99.5554444443333......2333444444444 PP

               YABBY  95 svsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                          ++ + +++  d++ pr pp ir PekrqrvPsaynrfikeeiqrikasnPdishreafs+aaknWahfP+ihfgl
  Sopim06g073920.0.1  93 FHRFSPIPT--DHDQPRSPP-IRVPEKRQRVPSAYNRFIKEEIQRIKASNPDISHREAFSTAAKNWAHFPHIHFGL 165
                         455555555..556688888.9****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046909.1E-7311165IPR006780YABBY protein
SuperFamilySSF470951.83E-8104158IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.103.2E-5112159IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
GO:0010158Biological Processabaxial cell fate specification
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MSLDMTYSSS SSERVCYVHC NFCSTILAVS VPCNSMMTIV TVRCGHCANL LSVNIAPSLQ  60
SLPIQDLQRQ NESSIEDGMS RGYGSSSSST NSFHRFSPIP TDHDQPRSPP IRVPEKRQRV  120
PSAYNRFIKE EIQRIKASNP DISHREAFST AAKNWAHFPH IHFGLKLDGN KQTNKLDHAV  180
AGEGPQKTIG LY*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6677670.0KJ667767.1 Solanum virginianum YAB2 protein mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004241356.11e-143PREDICTED: putative axial regulator YABBY 2 isoform X2
SwissprotQ9XFB03e-78YAB2_ARATH; Putative axial regulator YABBY 2
TrEMBLK4C9B01e-143K4C9B0_SOLLC; Uncharacterized protein
STRINGSolyc06g073920.2.11e-143(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38124163
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08465.13e-74YABBY family protein