PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim05g005390.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NF-YB
Protein Properties Length: 239aa    MW: 26551.5 Da    PI: 4.8921
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim05g005390.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB156.54.5e-4959152295
               NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 
                         reqdrf+Pianv+r m+k+lP naki++++k ++qecvsefisfvt+ea+d+c+ ekrkti+++dllwa+ +lGf+dyvepl++yl++yre
  Sopim05g005390.0.1  59 REQDRFMPIANVVRNMRKILPPNAKIADESKLVIQECVSEFISFVTGEANDRCKLEKRKTITAEDLLWAMNSLGFDDYVEPLTLYLQRYRE 149
                         89***************************************************************************************** PP

               NF-YB  93 leg 95 
                         l+g
  Sopim05g005390.0.1 150 LDG 152
                         987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.4E-4652156IPR009072Histone-fold
SuperFamilySSF471131.86E-3561156IPR009072Histone-fold
PfamPF008081.2E-2164128IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.9E-1792110No hitNo description
PROSITE patternPS00685095111IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.9E-17111129No hitNo description
PRINTSPR006151.9E-17130148No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MANNNNVGSG NGGFYNYRRS PQPTLARSPS SDMERSVELP SHLNQEIAAS EEDSECTIRE  60
QDRFMPIANV VRNMRKILPP NAKIADESKL VIQECVSEFI SFVTGEANDR CKLEKRKTIT  120
AEDLLWAMNS LGFDDYVEPL TLYLQRYREL DGGERGSLRV DHFPLKRPTV NPSSGYSLMP  180
NHLPPNFSMA NHNGYYVYPP PIDNSYRQGD ASSGSTSHEC AVAAVDGDVK SPAEKSEE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_B1e-3757149294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A1e-3757149294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755170.0HG975517.1 Solanum lycopersicum chromosome ch05, complete genome.
GenBankAC2040820.0AC204082.1 Solanum lycopersicum cv. Heinz 1706, chromosome 5 BAC clone C05SLe0086I08, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004239344.11e-178PREDICTED: nuclear transcription factor Y subunit B-4-like
SwissprotQ84W668e-57NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLK4BW701e-178K4BW70_SOLLC; Uncharacterized protein
STRINGSolyc05g005390.1.11e-178(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.23e-57nuclear factor Y, subunit B6