PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim05g005350.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NF-YB
Protein Properties Length: 220aa    MW: 24434.8 Da    PI: 4.1791
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim05g005350.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB97.31.3e-3049132287
               NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvyl 87 
                         +eqd+++P  nv+rim+ + P++ kis+dak t+ +c+sefi fvt ea+ +cqre+r+ti+ +d+ w + ++Gf+dy+epl  y+
  Sopim05g005350.0.1  49 QEQDEVIP--NVARIMHSTHPSHVKISDDAKRTMYHCMSEFICFVTYEANTHCQREQRNTITVEDVDWVINKFGFDDYIEPLPYYF 132
                         56777766..************************************************************************9996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.109.8E-2749131IPR009072Histone-fold
SuperFamilySSF471132.85E-2256134IPR009072Histone-fold
PfamPF008089.3E-1757116IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MDGGSGNGGF HSYRRSPQPT PADPPSSDVE MSLELPAHLN QEVDEIISQE QDEVIPNVAR  60
IMHSTHPSHV KISDDAKRTM YHCMSEFICF VTYEANTHCQ REQRNTITVE DVDWVINKFG  120
FDDYIEPLPY YFPPNSEDDG GECGSLTRES LLKCPMVDTA SSSNITPYSV PPNFPMAHHH  180
FVYPPPMGNG DMQGEASTSQ YAGVSVDTDV ESPMEEDKE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B2e-2049137292Transcription factor HapC (Eurofung)
4g92_B2e-2049137292Transcription factor HapC (Eurofung)
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755170.0HG975517.1 Solanum lycopersicum chromosome ch05, complete genome.
GenBankAC2040820.0AC204082.1 Solanum lycopersicum cv. Heinz 1706, chromosome 5 BAC clone C05SLe0086I08, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004239341.11e-164PREDICTED: nuclear transcription factor Y subunit B-6-like isoform X2
TrEMBLK4BW661e-164K4BW66_SOLLC; Uncharacterized protein
STRINGSolyc05g005350.1.11e-164(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14016414
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.15e-35nuclear factor Y, subunit B6