PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim04g049910.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NF-YB
Protein Properties Length: 166aa    MW: 17776.8 Da    PI: 4.8585
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim04g049910.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB177.99.6e-5627122297
               NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 
                         reqdr+lPian++rimkk+lPan+ki+kd+k+tvqecvsefisf+tseasdkcq+ekrktingddll alatlGfedy+eplkvyl++yre
  Sopim04g049910.0.1  27 REQDRYLPIANIGRIMKKALPANGKIAKDSKDTVQECVSEFISFITSEASDKCQKEKRKTINGDDLLSALATLGFEDYIEPLKVYLTRYRE 117
                         89***************************************************************************************** PP

               NF-YB  93 legek 97 
                         +eg+ 
  Sopim04g049910.0.1 118 MEGDA 122
                         ***96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.107.6E-5223126IPR009072Histone-fold
SuperFamilySSF471131.43E-3829124IPR009072Histone-fold
PfamPF008082.9E-273296IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006154.7E-206078No hitNo description
PROSITE patternPS0068506379IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006154.7E-207997No hitNo description
PRINTSPR006154.7E-2098116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MAEPASPGGG GGSHESGGDP SPQSNLREQD RYLPIANIGR IMKKALPANG KIAKDSKDTV  60
QECVSEFISF ITSEASDKCQ KEKRKTINGD DLLSALATLG FEDYIEPLKV YLTRYREMEG  120
DAKGSARVGD ASVRKDVVGC QLGSNTQFMY EGSFAQGLDY GNSQL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_B6e-4726117192Transcription factor HapC (Eurofung)
4g91_B6e-4726117192Transcription factor HapC (Eurofung)
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755161e-120HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
GenBankHG9754431e-120HG975443.1 Solanum pennellii chromosome ch04, complete genome.
GenBankCU4578061e-120CU457806.5 S.lycopersicum DNA sequence from clone SL_MboI-28J22 on chromosome 4, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010319840.11e-120PREDICTED: nuclear transcription factor Y subunit B-10-like
RefseqXP_004237524.11e-120PREDICTED: nuclear transcription factor Y subunit B-10-like
SwissprotQ8VYK43e-76NFYB8_ARATH; Nuclear transcription factor Y subunit B-8
TrEMBLK4BRW41e-120K4BRW4_SOLLC; Uncharacterized protein
STRINGSolyc04g049910.2.11e-119(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53340.14e-72nuclear factor Y, subunit B10