PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim04g015060.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NF-YB
Protein Properties Length: 238aa    MW: 26414.2 Da    PI: 5.8943
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim04g015060.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB169.34.4e-5356150195
               NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 
                         vreqdrf+Pianv+rim+k+lP +akis+daket+qecvsefisfvt+ea+d+cqre+rkti+++d+lwa+++lGf+dy+epl+++l++yr
  Sopim04g015060.0.1  56 VREQDRFMPIANVIRIMRKTLPPHAKISDDAKETIQECVSEFISFVTGEANDRCQREQRKTITAEDVLWAMSKLGFDDYIEPLTMHLHRYR 146
                         69***************************************************************************************** PP

               NF-YB  92 eleg 95 
                         e++g
  Sopim04g015060.0.1 147 ECDG 150
                         *986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.109.6E-5051155IPR009072Histone-fold
SuperFamilySSF471136.52E-3859157IPR009072Histone-fold
PfamPF008081.7E-2662126IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.5E-1690108No hitNo description
PROSITE patternPS00685093109IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.5E-16109127No hitNo description
PRINTSPR006151.5E-16128146No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MDLGGGNGSG GFHGYRRFPQ TTSADGIATL NQAIPTTNHL NDNNNASVPD DSECTVREQD  60
RFMPIANVIR IMRKTLPPHA KISDDAKETI QECVSEFISF VTGEANDRCQ REQRKTITAE  120
DVLWAMSKLG FDDYIEPLTM HLHRYRECDG GDRGSLRGEP LMLMKSRGAM VDPAASTSIG  180
NNMTHVNYPL PPNFTMTHHH HGYYTYAHMT NDNVATNSQA NLDEANNNVE SFGEHNK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A3e-3955147193NF-YB
4csr_A3e-3955147294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4awl_B3e-3955147294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755160.0HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010319221.10.0PREDICTED: nuclear transcription factor Y subunit B-6-like
RefseqXP_015073076.10.0PREDICTED: nuclear transcription factor Y subunit B-6-like
SwissprotQ84W669e-68NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLK4BQ090.0K4BQ09_SOLLC; Uncharacterized protein
STRINGSolyc04g015060.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.22e-65nuclear factor Y, subunit B6