PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim03g113270.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 324aa    MW: 36648.2 Da    PI: 4.8893
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim03g113270.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.84.2e-1990143356
                         --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         k++++t++q++ Le+ F +++++  e++ +LAk+lgL+ rq+ +WFqNrRa++k
  Sopim03g113270.0.1  90 KKRRLTDNQVQFLEKSFGEENKLEPERKVQLAKELGLQPRQIAIWFQNRRARWK 143
                         56689************************************************9 PP

2HD-ZIP_I/II1291.9e-4189179191
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         ekkrrl+++qv++LE+sF ee+kLeperKv+la+eLglqprq+a+WFqnrRAR+ktkqlEkdy+ L+++yd+lk++ ++L ke+e+Lr+e+
  Sopim03g113270.0.1  89 EKKRRLTDNQVQFLEKSFGEENKLEPERKVQLAKELGLQPRQIAIWFQNRRARWKTKQLEKDYDELRNRYDTLKSNYNNLLKEKEDLRTEV 179
                         69**************************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.17E-1980147IPR009057Homeodomain-like
PROSITE profilePS5007117.57285145IPR001356Homeobox domain
SMARTSM003896.8E-1988149IPR001356Homeobox domain
PfamPF000461.7E-1690143IPR001356Homeobox domain
CDDcd000861.67E-1790146No hitNo description
Gene3DG3DSA:1.10.10.609.3E-2091152IPR009057Homeodomain-like
PRINTSPR000316.3E-6116125IPR000047Helix-turn-helix motif
PROSITE patternPS000270120143IPR017970Homeobox, conserved site
PRINTSPR000316.3E-6125141IPR000047Helix-turn-helix motif
PfamPF021833.2E-15145186IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MAPGILYGGS SNFDGVFTQK QRDVFSSSTA PKGHLGSLFA PASSSSNFLG SSSMVSFRGV  60
NGGKRSFFDS FDQDDNEADE LGEYLHQAEK KRRLTDNQVQ FLEKSFGEEN KLEPERKVQL  120
AKELGLQPRQ IAIWFQNRRA RWKTKQLEKD YDELRNRYDT LKSNYNNLLK EKEDLRTEVF  180
RLTGKLFIKE KGNGQLDLRD EHKHSNALAK ETVVDPMSNV PALVVKHQQE DLSSAKSDVF  240
DSESPRYTSR MHSSVVDQDD SARAFETDQS DSSQDDDENF SKNMLSTANL LGKDADDDYP  300
ATSSNLSYFG FPVEDQGFGF WTY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1137145RRARWKTKQ
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755150.0HG975515.1 Solanum lycopersicum chromosome ch03, complete genome.
GenBankX949470.0X94947.1 L.esculentum mRNA for homeobox protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001234250.20.0homeobox-leucine zipper protein HAT5-like
TrEMBLA0A3Q7FRX50.0A0A3Q7FRX5_SOLLC; Uncharacterized protein
TrEMBLQ435290.0Q43529_SOLLC; Homeobox
STRINGSolyc03g113270.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8252495
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.15e-42homeobox 1