PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim03g046440.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 174aa    MW: 20277.6 Da    PI: 6.626
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim03g046440.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.13.8e-1370128563
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         ++ rr+++NRe+ArrsR RK++ + eL   v  L +eN+ L ++l++ +k  +++  e+
  Sopim03g046440.0.1  70 RKKRRMISNRESARRSRMRKQKHLNELWAQVNCLRNENHLLLNKLNHVSKIHDQVLEEN 128
                         6789********************************************99998887776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.7E-1366130IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.34668131IPR004827Basic-leucine zipper domain
PfamPF001703.2E-1170128IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.86E-1270119No hitNo description
Gene3DG3DSA:1.20.5.1707.9E-1170143No hitNo description
CDDcd147024.92E-1971122No hitNo description
PROSITE patternPS0003607388IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MQSTNVTELY YNPAQYNYTP TFHDQSINRI PSPLYHLQIG PPIQQLNSQS TYFNTNNSTC  60
DEIDELINER KKRRMISNRE SARRSRMRKQ KHLNELWAQV NCLRNENHLL LNKLNHVSKI  120
HDQVLEENAQ LKEETAGLRQ IVTNMHLMDG PNYPLKEIQL DDDEPCSGSS QNE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16990RKKRRMISNRESARRSRMRKQK
28289RRSRMRKQ
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755151e-166HG975515.1 Solanum lycopersicum chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019068255.11e-127basic leucine zipper 43-like
TrEMBLA0A3Q7G6R21e-124A0A3Q7G6R2_SOLLC; Uncharacterized protein
STRINGSolyc03g046440.1.11e-126(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9472492
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.19e-32basic leucine-zipper 42