PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim02g078620.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Dof
Protein Properties Length: 285aa    MW: 32262.8 Da    PI: 6.4163
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim02g078620.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof110.67.3e-354096359
              zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59
                        +++lkcprCds ntkfCyynny+ sqPr++Ck+C+r+Wt+GG+lrnvPvGggr++++
  Sopim02g078620.0.1 40 SESLKCPRCDSINTKFCYYNNYNKSQPRHYCKGCKRHWTEGGTLRNVPVGGGRKNKR 96
                        6789***********************************************976665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-233996IPR003851Zinc finger, Dof-type
PfamPF027016.9E-314295IPR003851Zinc finger, Dof-type
PROSITE profilePS5088426.9724397IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104581IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MGLSTKLVSI DDDGLDNWTT TTHNTRPEPP SIRRQLPSKS ESLKCPRCDS INTKFCYYNN  60
YNKSQPRHYC KGCKRHWTEG GTLRNVPVGG GRKNKRVRPT DPVDHINGRK HVRLEVNDQR  120
CPLITTTSMT NSIITSSILP SVTLIRGNST ITSAIDEDIK NLTSSSLPYD IFSNISQDHG  180
NTHFSLIPNS STNTQLSSNV YYNYEHMGKF DSTILEESTI TTIMPITSNN DLHSYEPWKV  240
PETSNNDLII DENMSNNYWN WNEFETLSNA ADLNISWDDL EIKP*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755140.0HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
GenBankAC2327780.0AC232778.1 Solanum lycopersicum cultivar Heinz 1706 chromosome 2 clone C02SLm0127N23, complete sequence.
GenBankAC2327700.0AC232770.1 Solanum lycopersicum cultivar Heinz 1706 chromosome 2 clone C02HBa0104K03, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006347078.10.0PREDICTED: dof zinc finger protein DOF2.2-like
TrEMBLK4B9860.0K4B986_SOLLC; Uncharacterized protein
STRINGSolyc02g078620.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61712033
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.12e-29TARGET OF MONOPTEROS 6