PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim02g077450.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family VOZ
Protein Properties Length: 468aa    MW: 52068.3 Da    PI: 5.0769
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim02g077450.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ4098.9e-1261874061217
                 VOZ   1 pppsaflgpkcalwdctrpaqgsewlq...dycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaataks 88 
                         pppsaflgpkcalwdc+rpa gs+w+q   dycs +ha+la neg +g  pv+rp g++lkd+llf+alsak++gk+vg+pec gaataks
  Sopim02g077450.0.1 187 PPPSAFLGPKCALWDCPRPAMGSDWCQkshDYCSDYHAALAPNEGYLGRPPVVRPMGVGLKDSLLFQALSAKAHGKDVGVPECRGAATAKS 277
                         89***********************976668************************************************************ PP

                 VOZ  89 pwnaaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeinelda 179
                         pwna+elfdl+++egetirewlffdkprrafesgnrkqrslpdy+grgwhesrkqv++++gglkrsyymdpqp++++ewhlyeyein++da
  Sopim02g077450.0.1 278 PWNAPELFDLEVVEGETIREWLFFDKPRRAFESGNRKQRSLPDYNGRGWHESRKQVINDYGGLKRSYYMDPQPMKNLEWHLYEYEINKYDA 368
                         ******************************************************************************************* PP

                 VOZ 180 lalyrlelklvdekksakgkvskdsladlqkklgrlta 217
                          alyrlelklvd+kks+kgkv+++s+adlqk++grl+a
  Sopim02g077450.0.1 369 WALYRLELKLVDGKKSPKGKVMNESVADLQKQMGRLSA 406
                         ************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    Send to blast
MGKGSKNGAL FKDKAKNRVD DLQGMFMNLQ SARKESRTHD AGLLEEQVHQ MLREWKAELN  60
EPSPASSLQG GSRISSDLYR LLHGEEEDDA TSALAAPKPE PDAQKQDVAG FQEDFNATPV  120
MQEQGYQLDD ECKNTPLAVN NAGINNEGVA TQLDYHSFDL QQDFDQFGFD ALNLCLEENL  180
SPIQISPPPS AFLGPKCALW DCPRPAMGSD WCQKSHDYCS DYHAALAPNE GYLGRPPVVR  240
PMGVGLKDSL LFQALSAKAH GKDVGVPECR GAATAKSPWN APELFDLEVV EGETIREWLF  300
FDKPRRAFES GNRKQRSLPD YNGRGWHESR KQVINDYGGL KRSYYMDPQP MKNLEWHLYE  360
YEINKYDAWA LYRLELKLVD GKKSPKGKVM NESVADLQKQ MGRLSADIPL ENKRSVKGRG  420
KANSKDVVSN GPPAPNQTVP AIEGFDYVAG APFPDYLVDN IGGYYIT*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755140.0HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004232932.10.0transcription factor VOZ1
RefseqXP_010316788.10.0transcription factor VOZ1
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A3Q7F3H40.0A0A3Q7F3H4_SOLLC; Uncharacterized protein
STRINGSolyc02g077450.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28182454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]