PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim02g065800.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family TCP
Protein Properties Length: 143aa    MW: 16204.5 Da    PI: 9.6825
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim02g065800.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP98.41.3e-3043111270
                 TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssa 70 
                          g+kdrhsk+ T +g+RdRRvRls+++a +++dLqd+LG+d++sk ++WLl++ak+ i+el+ ++  ++
  Sopim02g065800.0.1  43 FGGKDRHSKVLTVKGLRDRRVRLSVPTALQVYDLQDKLGLDQPSKVVDWLLNEAKHDIDELPPLQIRDQ 111
                         689***********************************************************9955444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136929.9945103IPR017887Transcription factor TCP subgroup
PfamPF036342.4E-2945130IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 143 aa     Download sequence    Send to blast
MISREVDPSD NNVIMIPKKS SLSSSSSWTR FKDPRIVRVS RAFGGKDRHS KVLTVKGLRD  60
RRVRLSVPTA LQVYDLQDKL GLDQPSKVVD WLLNEAKHDI DELPPLQIRD QTGLPLTGLR  120
KEEEETMVVS DEDRVKLDVR NT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A1e-1950104155Putative transcription factor PCF6
5zkt_B1e-1950104155Putative transcription factor PCF6
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164). Binds to the 3'-ACC-5' repeats in the light-responsive promoter (LRP) of psbD, and activates its transcription. Participates in ovule develpment (PubMed:25378179). {ECO:0000269|PubMed:11161017, ECO:0000269|PubMed:17307931, ECO:0000269|PubMed:25378179}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755140.0HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004253504.35e-97transcription factor TCP17-like
SwissprotQ9S7W52e-40TCP13_ARATH; Transcription factor TCP13
TrEMBLA0A494GA561e-95A0A494GA56_SOLLC; Uncharacterized protein
STRINGSolyc02g065800.1.14e-97(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8212499
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02150.17e-43plastid transcription factor 1
Publications ? help Back to Top
  1. Skinner MK,Rawls A,Wilson-Rawls J,Roalson EH
    Basic helix-loop-helix transcription factor gene family phylogenetics and nomenclature.
    Differentiation, 2010. 80(1): p. 1-8
    [PMID:20219281]
  2. Yamburenko MV,Zubo YO,Börner T
    Abscisic acid affects transcription of chloroplast genes via protein phosphatase 2C-dependent activation of nuclear genes: repression by guanosine-3'-5'-bisdiphosphate and activation by sigma factor 5.
    Plant J., 2015. 82(6): p. 1030-41
    [PMID:25976841]
  3. Koyama T,Sato F,Ohme-Takagi M
    Roles of miR319 and TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2017. 175(2): p. 874-885
    [PMID:28842549]