PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim02g032190.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NF-YB
Protein Properties Length: 96aa    MW: 10702.1 Da    PI: 4.8431
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim02g032190.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB75.76.9e-242780255
               NF-YB  2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcq 55
                        reqdrf Pianv+r m+k+lP naki+++++ ++qecvsefisfvt+ea++++ 
  Sopim02g032190.0.1 27 REQDRFTPIANVVRNMRKILPPNAKIADESQLVIQECVSEFISFVTGEANNHAS 80
                        89************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.106.2E-212380IPR009072Histone-fold
SuperFamilySSF471134.66E-142982IPR009072Histone-fold
PfamPF008082.3E-123480IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 96 aa     Download sequence    Send to blast
MERSMELPSH LNKEIVANEE DLECTIREQD RFTPIANVVR NMRKILPPNA KIADESQLVI  60
QECVSEFISF VTGEANNHAS LSSTRQSPLK TCFGP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B1e-162676151Transcription factor HapC (Eurofung)
4g92_B1e-162676151Transcription factor HapC (Eurofung)
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2467521e-160AC246752.2 Solanum lycopersicum strain Heinz 1706 chromosome 2 clone slm-46o2 map 2, complete sequence.
GenBankHG9755141e-160HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006356442.23e-44PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X2
RefseqXP_015168332.16e-44PREDICTED: nuclear transcription factor Y subunit B-8-like isoform X1
RefseqXP_015168333.16e-44PREDICTED: nuclear transcription factor Y subunit B-8-like isoform X1
RefseqXP_015168334.13e-44PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X2
SwissprotQ84W663e-25NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLK4B5G54e-65K4B5G5_SOLLC; Uncharacterized protein
STRINGSolyc02g032190.1.11e-64(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA2669422
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.21e-26nuclear factor Y, subunit B6