PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim02g014750.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GeBP
Protein Properties Length: 158aa    MW: 18185 Da    PI: 8.4767
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim02g014750.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57354.82.6e-1770133265
              DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKf 65 
                         lf+++w +eDei+lL+G+i+fk++t  + ++ +++f+ f+  s+ ++ ++ ql eKirrLKk  
  Sopim02g014750.0.1  70 LFSKVWCDEDEISLLKGIIKFKEQTACEITQCMTEFCAFILPSLTLQPTRVQLREKIRRLKKSM 133
                         699**********************************************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045044.3E-1471134IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 158 aa     Download sequence    Send to blast
MTENSTTGAA NCSVEFVREE EEVVSNKRKN DDIDVTRFLY NDTPSDGYYQ EKTPSPKPKR  60
MMNLKSKPPL FSKVWCDEDE ISLLKGIIKF KEQTACEITQ CMTEFCAFIL PSLTLQPTRV  120
QLREKIRRLK KSMKRLLPQE IRLIQTCTNS NCSSYVT*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1128134LKKSMKR
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755140.0HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025884855.13e-89probable transcription factor At4g00610, partial
TrEMBLA0A3Q7EVH11e-112A0A3Q7EVH1_SOLLC; Uncharacterized protein
STRINGSolyc02g014750.1.11e-112(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA138051214
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00390.12e-10DNA-binding storekeeper protein-related transcriptional regulator