PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim02g014740.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GeBP
Protein Properties Length: 224aa    MW: 26287.7 Da    PI: 9.5775
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim02g014740.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57371.31.9e-2270161297
              DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifels 92 
                         lf+++ws+eDe++lL+G+i+fk++t  + ++ +++f  f+  s+ ++ ++ ql eKirrLKk+++k  ++   g+  s +  h+ + f+l+
  Sopim02g014740.0.1  70 LFSKVWSDEDEVSLLKGIIKFKEQTACEITQCMTEFRAFILPSLTLQPTRVQLREKIRRLKKRYEKTLAT---GN-SSNTDVHQLELFQLC 156
                         699****************************************************************999...44.47789999******* PP

              DUF573  93 kkiWg 97 
                         ++iW 
  Sopim02g014740.0.1 157 HIIWT 161
                         ****7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045044.7E-2171160IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MTENSTTGAA NCSVEFVREE EEIVSNKRKN DDIDVTRFLY NDTPSDGYYQ EKTPSPKPKR  60
KMNLKSKPPL FSKVWSDEDE VSLLKGIIKF KEQTACEITQ CMTEFRAFIL PSLTLQPTRV  120
QLREKIRRLK KRYEKTLATG NSSNTDVHQL ELFQLCHIIW TQPPNSLLLK EKREDGLQVK  180
EKHNNPELEK QNIQVNEKKH NIPQKGQPEK QERKHNMRPI QQHX
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755140.0HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025884855.11e-164probable transcription factor At4g00610, partial
TrEMBLA0A3Q7EVX91e-163A0A3Q7EVX9_SOLLC; Uncharacterized protein
STRINGSolyc02g014740.1.11e-163(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA138051214
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00390.15e-13DNA-binding storekeeper protein-related transcriptional regulator