PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim01g099320.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NF-YB
Protein Properties Length: 147aa    MW: 16727.8 Da    PI: 4.9004
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim01g099320.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB147.82.2e-46496395
               NF-YB  3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95
                        e+ +++Pianv+rimk++lP  akisk+aket+qec+sefisfvt+easdkc++e+r+t+ngdd++wal++lGf++y+e +  yl k r++e+
  Sopim01g099320.0.1  4 EHVKLVPIANVGRIMKQILPPTAKISKEAKETMQECASEFISFVTGEASDKCHKENRRTVNGDDICWALSSLGFDNYAEVMLRYLYKLRDFER 96
                        566899*************************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.6E-436120IPR009072Histone-fold
SuperFamilySSF471135.37E-349117IPR009072Histone-fold
PfamPF008083.8E-26972IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006155.3E-173654No hitNo description
PROSITE patternPS0068503955IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006155.3E-175573No hitNo description
PRINTSPR006155.3E-177492No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
MVDEHVKLVP IANVGRIMKQ ILPPTAKISK EAKETMQECA SEFISFVTGE ASDKCHKENR  60
RTVNGDDICW ALSSLGFDNY AEVMLRYLYK LRDFERVRAN QNKLGLNDDD NTDDDDDDGE  120
ARRASTTSLA PLEINVMERV QRRRFN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B5e-37293192Transcription factor HapC (Eurofung)
4g92_B5e-37293192Transcription factor HapC (Eurofung)
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755130.0HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
GenBankAC1937770.0AC193777.1 Solanum lycopersicum chromosome 1 clone C01HBa0051C14, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004231278.11e-106PREDICTED: nuclear transcription factor Y subunit B-4-like
SwissprotO040271e-50NFYB4_ARATH; Nuclear transcription factor Y subunit B-4
TrEMBLK4B0W91e-106K4B0W9_SOLLC; Uncharacterized protein
STRINGSolyc01g099320.2.11e-106(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.17e-51nuclear factor Y, subunit B5