PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim00g270510.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NF-YB
Protein Properties Length: 185aa    MW: 21316.5 Da    PI: 6.7926
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim00g270510.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB147.62.7e-4622114395
               NF-YB   3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93 
                         eqd+f+Pian+++im+++lP++akis+d+k+t+qecvsefis++t ea+++cq e+rkt++ +d+lwa++++Gf+d++epl++yl++yre+
  Sopim00g270510.0.1  22 EQDQFMPIANMVKIMRRILPSHAKISNDSKQTIQECVSEFISLITLEANNRCQSEQRKTVTHKDILWAMSKVGFDDFIEPLTLYLNQYREF 112
                         8*****************************************************************************************9 PP

               NF-YB  94 eg 95 
                         +g
  Sopim00g270510.0.1 113 DG 114
                         87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.6E-4218119IPR009072Histone-fold
SuperFamilySSF471131.86E-3423120IPR009072Histone-fold
PfamPF008082.9E-232690IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006154.0E-115472No hitNo description
PRINTSPR006154.0E-117391No hitNo description
PRINTSPR006154.0E-1192110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MERRTGMSSH VNQAITECIT LEQDQFMPIA NMVKIMRRIL PSHAKISNDS KQTIQECVSE  60
FISLITLEAN NRCQSEQRKT VTHKDILWAM SKVGFDDFIE PLTLYLNQYR EFDGGESESL  120
RGEPLLLKHQ IAHHHGYFVS PPPTGNNDMQ GIHQMEALLS VHWLPWIVTL SLLWKRVRSD  180
QLLY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A2e-3422111493NF-YB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754410.0HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015168350.19e-99PREDICTED: nuclear transcription factor Y subunit B-6-like
SwissprotQ9SFD83e-53NFYB9_ARATH; Nuclear transcription factor Y subunit B-9
TrEMBLM1B1U51e-98M1B1U5_SOLTU; Uncharacterized protein
STRINGSolyc00g270510.1.11e-136(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21970.12e-54NF-YB family protein