PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen12g034520.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRAS
Protein Properties Length: 468aa    MW: 52637.3 Da    PI: 6.4504
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen12g034520.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS478.63.1e-146474651374
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                       l++lLl+cA++v+sg+le+a+ +L ++s+lasp+gd+mqR+a+yfteALa r++rs+++lykal++++ s   +see+ ++k+f+e++P+lk+
  Sopen12g034520.1  47 LIHLLLACANHVASGSLENANIALDHISQLASPSGDTMQRIASYFTEALADRILRSWPGLYKALRSTKLS--VVSEEILVRKMFFEIFPFLKV 137
                       689*************************************************************999998..6******************** PP

              GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrl 186
                       +++++NqaI ea+ege++vHi+D+++ ++lQW aLlq L++Rpegpp+lRiTgv++    +ke l ++++ L++ Ae+l++pf+fn  v++rl
  Sopen12g034520.1 138 AFVVTNQAIIEAMEGEKMVHIVDLNAAEPLQWRALLQDLSARPEGPPHLRITGVHQ----QKEVLDQMAHVLTQEAEKLDIPFQFNQ-VVSRL 225
                       ********************************************************....9**************************.7**** PP

              GRAS 187 edleleeLrvkpgEalaVnlvlqlhrll......................................................desvsleserd 225
                       e+l++e+Lrvk+gEala+++++qlh+ll                                                       +++s+  + d
  Sopen12g034520.1 226 ENLDVEKLRVKTGEALAISSIMQLHTLLahdnekksplpfkhsngvnlnralvnqntlgeflekdmangcspsndtasssplCSTGST--KMD 316
                       **************************************************************************99885554333333..569 PP

              GRAS 226 evLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrer 318
                       ++L+++++lsPkv+v++eq+a+hn+++++er++e+l++y+alfd+le++lpr+s er kvE++llg+ei+n++aceg er+erhe+lekW +r
  Sopen12g034520.1 317 SFLNALWGLSPKVMVITEQDANHNGTTLMERLSESLHFYAALFDCLESTLPRTSLERLKVEKMLLGEEIRNIIACEGIERKERHEKLEKWFQR 409
                       9******************************************************************************************** PP

              GRAS 319 leeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                       ++++GF++vpls++a+ qa++ll+ ++ +gy+++e++g++v++W+drpL+svS+Wr
  Sopen12g034520.1 410 FDTSGFGNVPLSYYAMLQARRLLQSYSCEGYKIKEDNGCVVICWQDRPLFSVSSWR 465
                       *******************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.69521445IPR005202Transcription factor GRAS
PfamPF035141.1E-14347465IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    Send to blast
MLQDDGSSSV TSSSPIQVFP MMSVSPSFGS SNQWLKELKS EERGLYLIHL LLACANHVAS  60
GSLENANIAL DHISQLASPS GDTMQRIASY FTEALADRIL RSWPGLYKAL RSTKLSVVSE  120
EILVRKMFFE IFPFLKVAFV VTNQAIIEAM EGEKMVHIVD LNAAEPLQWR ALLQDLSARP  180
EGPPHLRITG VHQQKEVLDQ MAHVLTQEAE KLDIPFQFNQ VVSRLENLDV EKLRVKTGEA  240
LAISSIMQLH TLLAHDNEKK SPLPFKHSNG VNLNRALVNQ NTLGEFLEKD MANGCSPSND  300
TASSSPLCST GSTKMDSFLN ALWGLSPKVM VITEQDANHN GTTLMERLSE SLHFYAALFD  360
CLESTLPRTS LERLKVEKML LGEEIRNIIA CEGIERKERH EKLEKWFQRF DTSGFGNVPL  420
SYYAMLQARR LLQSYSCEGY KIKEDNGCVV ICWQDRPLFS VSSWRCRK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A1e-40294671381Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754510.0HG975451.1 Solanum pennellii chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015061792.10.0scarecrow-like protein 3
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLA0A3Q7JDZ10.0A0A3Q7JDZ1_SOLLC; Uncharacterized protein
STRINGSolyc12g099900.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29142453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3
Publications ? help Back to Top
  1. Gong X, et al.
    SEUSS Integrates Gibberellin Signaling with Transcriptional Inputs from the SHR-SCR-SCL3 Module to Regulate Middle Cortex Formation in the Arabidopsis Root.
    Plant Physiol., 2016. 170(3): p. 1675-83
    [PMID:26818732]
  2. Lee SA, et al.
    Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue.
    Mol Plant, 2016. 9(6): p. 870-84
    [PMID:26970019]
  3. Choi JW,Lim J
    Control of Asymmetric Cell Divisions during Root Ground Tissue Maturation.
    Mol. Cells, 2016. 39(7): p. 524-9
    [PMID:27306644]