PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen12g033900.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRAS
Protein Properties Length: 507aa    MW: 58769.4 Da    PI: 5.3353
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen12g033900.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS284.43.2e-871224921374
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetsekn.sseelaalklfsevsPil 91 
                       lve Ll+ Ae v ++    a  lL++  +l+ ++g p++Rl+ yf +AL++r+   +++++ k l  ++ ++ + + ++++a ++ ++  P+ 
  Sopen12g033900.1 122 LVERLLASAEKVGEKVYDIAIDLLNECDKLSYKTGHPVERLVYYFSRALRERVDIeTGKNCTKGLGIRRMRDLQeTLRSINACTIAVQDMPMC 214
                       57899************************************************876999******98888876558888999999******** PP

              GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvak 184
                       ++  +   qaIle ve+++++Hi+D++i++G+QW  L+qa+a++ ++   l++T++ + +  s++++eetg+rL +fA++l+ p+ f++++++
  Sopen12g033900.1 215 EVVKFSGIQAILENVESSKKIHIVDLEIKMGVQWTILMQAFATQCSNLEYLKVTALIDVQ--SRTNVEETGKRLMSFAKSLHFPLCFKIVMVE 305
                       **********************************************************66..******************************* PP

              GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                       ++ dl+ e+L+++p+E+laV +++ l ++     + +++ d ++ ++k+l+P+v++v+e ea++ns+ F++rf+eal y+ a fd +e  + +
  Sopen12g033900.1 306 DIFDLKREDLDIDPEESLAVYSQFLLSNMI----THQDRLDFLMGFIKGLNPRVMIVAEVEANLNSPVFVNRFIEALFYHGAYFDLFEDCMRN 394
                       ************************999998....555567779************************************************99 PP

              GRAS 278 eseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvs 369
                       ++++r+ +E+e++   i+n++a+eg+er++rh t e Wre ++++G++++++s++   qak++++k+  ++ +++e +++ +++gWk+ pL s
  Sopen12g033900.1 395 NESTRNAMEEEVMWHGIRNIIANEGEERTMRHVTIELWREYFKRFGMEEMKMSDSSLYQAKTVVEKFTgKNSFTLEMNENFVTIGWKGTPLNS 487
                       99******************************************************************9999********************* PP

              GRAS 370 vSaWr 374
                       +SaW+
  Sopen12g033900.1 488 LSAWK 492
                       ****8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098540.47696471IPR005202Transcription factor GRAS
PfamPF035141.1E-84122492IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 507 aa     Download sequence    Send to blast
MQEQNEQYSV KLDDWDFDVV DKTTTILYIK ETTDDNKRAN NSLISSLNIL KDFGNGFRKL  60
KGQKIDVVQI SENECTPSVC KLSTEEILRF GGQKFIQRIE FDHTFVNSLC SLSEEESRSV  120
MLVERLLASA EKVGEKVYDI AIDLLNECDK LSYKTGHPVE RLVYYFSRAL RERVDIETGK  180
NCTKGLGIRR MRDLQETLRS INACTIAVQD MPMCEVVKFS GIQAILENVE SSKKIHIVDL  240
EIKMGVQWTI LMQAFATQCS NLEYLKVTAL IDVQSRTNVE ETGKRLMSFA KSLHFPLCFK  300
IVMVEDIFDL KREDLDIDPE ESLAVYSQFL LSNMITHQDR LDFLMGFIKG LNPRVMIVAE  360
VEANLNSPVF VNRFIEALFY HGAYFDLFED CMRNNESTRN AMEEEVMWHG IRNIIANEGE  420
ERTMRHVTIE LWREYFKRFG MEEMKMSDSS LYQAKTVVEK FTGKNSFTLE MNENFVTIGW  480
KGTPLNSLSA WKFHKRSTFH RANYLTL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-3715549236375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754510.0HG975451.1 Solanum pennellii chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015060591.10.0DELLA protein RGL1-like
TrEMBLK4DHU30.0K4DHU3_SOLLC; Uncharacterized protein
STRINGSolyc12g099220.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA34272149
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.11e-51RGA-like 1