PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen12g032330.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family CO-like
Protein Properties Length: 356aa    MW: 39258.6 Da    PI: 5.7262
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen12g032330.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box185.9e-061143436
          zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg 36
                      + C+ ++  +++ fC+ ++ +lC  C  ++H  
  Sopen12g032330.1 11 KLCDSCKTSPATVFCRADSAFLCLGCDCKIHAA 43
                      68*************************999954 PP

2zf-B_box25.33.2e-085395339
          zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                       ++C+ +e+ +++  C+ +   lC +C   +H+       H++
  Sopen12g032330.1 53 VWVCEVCEQAPASVTCKADAAALCVTCDRDIHSAnplarrHER 95
                      689*****************************65777777776 PP

3CCT70.54.1e-24293336144
               CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                       Rea+++RY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  Sopen12g032330.1 293 REARVMRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT 336
                       9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003366.0E-10855IPR000315B-box-type zinc finger
PROSITE profilePS5011910.068855IPR000315B-box-type zinc finger
PfamPF006433.6E-51150IPR000315B-box-type zinc finger
CDDcd000212.63E-71255No hitNo description
PROSITE profilePS5011910.5945198IPR000315B-box-type zinc finger
PfamPF006432.2E-65397IPR000315B-box-type zinc finger
CDDcd000214.83E-95498No hitNo description
SMARTSM003361.6E-105698IPR000315B-box-type zinc finger
PROSITE profilePS5101716.896293335IPR010402CCT domain
PfamPF062032.3E-18293335IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MGTENWSLTA KLCDSCKTSP ATVFCRADSA FLCLGCDCKI HAANKLASRH ARVWVCEVCE  60
QAPASVTCKA DAAALCVTCD RDIHSANPLA RRHERFPVVP FYDSAVAKSH GGGDTDADAG  120
DDEKYFDSTN ENPSQPEEEA EAASWILPTP KEGTDQYKSA DYLFNDMDSY LDIDLMSCEQ  180
KPHILHHQQH QHNHYSSDGV VPVQNNNETT HLPGPVVDGF PTYELDFTGS KPYMYNFTSQ  240
SISQSVSSSS LDVGVVPDHS AMTDVSNTFV MNSSTGAIAG ADVVPNAVSG LDREARVMRY  300
REKRKNRKFE KTIRYASRKA YAETRPRIKG RFAKRTETEI DSLITVDASY GVVPSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0132600.0BT013260.1 Lycopersicon esculentum clone 134795F, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015061111.10.0zinc finger protein CONSTANS-LIKE 4-like
SwissprotQ940T91e-105COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLA0A3Q7JCU50.0A0A3Q7JCU5_SOLLC; Uncharacterized protein
STRINGSolyc12g096500.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.11e-100CONSTANS-like 4