PlantRegMap
Plant Transcription Factor Database
PlantTFDB
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen12g029540.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 363aa    MW: 41242.2 Da    PI: 7.9735
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen12g029540.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.77.9e-1179119343
                       XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNk 43 
                       ++k++rr+++NReAAr+sR RKka++++Le+   +L +  +
  Sopen12g029540.1  79 SDKVQRRLAQNREAARKSRMRKKAYVQQLEKSNLKLAQLEM 119
                       68****************************86655555544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.7E-477140IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.10579123IPR004827Basic-leucine zipper domain
PfamPF001701.4E-780119IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.44E-781117No hitNo description
Gene3DG3DSA:1.20.5.1705.2E-881124No hitNo description
PROSITE patternPS0003608499IPR004827Basic-leucine zipper domain
PfamPF141446.5E-29168240IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042742Biological Processdefense response to bacterium
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MNMSSTSTQF APTRRMGIFE PFHHMSMWED AFRGDIMPSV GACMVTPAND RADDKSGYTS  60
SDQLIPSGSE DNQAGKSISD KVQRRLAQNR EAARKSRMRK KAYVQQLEKS NLKLAQLEME  120
LERARQQGLY ILGSNGNMGL SSTINPGIAA FEMEYSLWVE EQQKKNVELR NILQSHVSEM  180
ELQLLVETVL NHYYNLFRIK ADAAKADVFY LMSGMWRTSV ERFFLWIGGF KPSELINIVM  240
PQLEPLSDQQ IVKICNLRHC CQQAEDALTQ GMDKLQQTLA QNILTMTTGM GSYSSQMVSS  300
MEKLEALESF VNQADHLRQQ TLQQMSLVLT TRQSARGLLA FGEYLQRLRA LSSLWAARPR  360
EPT
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. May be involved in the induction of the systemic acquired resistance (SAR) via its interaction with NPR1 (By similarity). {ECO:0000250, ECO:0000269|PubMed:12953119}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00247DAPTransfer from AT1G77920Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015060158.10.0transcription factor TGA1
RefseqXP_027769675.10.0transcription factor TGA1
RefseqXP_027769676.10.0transcription factor TGA1
SwissprotQ93ZE21e-152TGA7_ARATH; Transcription factor TGA7
TrEMBLM1BF040.0M1BF04_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000436510.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7802497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77920.11e-154bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]