PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen12g023800.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRAS
Protein Properties Length: 541aa    MW: 60985.4 Da    PI: 6.6981
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen12g023800.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS241.43.8e-741585362374
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                       ++lL  cA a+++g+l+++q+lL  l+el+s +gd+++Rlaa  ++AL   l+  +++  ++ ++ + +++n +   ++l  f+e+sP++++ 
  Sopen12g023800.1 158 EQLLNPCAAAITAGNLNRVQHLLYVLRELSSLNGDANHRLAARGLQALTYYLSTPCPTSLSSASAATFASTNPKFFKNSLINFNEISPWFRIP 250
                       689************************************************************9999999999999999999*********** PP

              GRAS  95 hltaNqaIleavege...ervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesg.........skeeleetgerLakfAeelgv 174
                       + +aN+ Il+ + ++   + +Hi+D+++s+G+QWp+Ll++L+ R+ ++pp +R+T++ +  ++               +   +L  fA+++++
  Sopen12g023800.1 251 NSIANSSILQILGKHdssRNLHILDIGVSHGVQWPTLLEELTHRAgGPPPLVRLTVITPTIEDgqqrnspfvVGPGGYNFSVQLLAFAKAINI 343
                       ************998777889************************55666*******9977667777777776777889999*********** PP

              GRAS 175 pfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh..ns.esFlerflealeyy 264
                       ++++n l    l++l+ + ++ +p+E l+++ +++lh+l    ++ ++er+e+Lk +ksl+Pk +v++e+++d+  ns ++F +rf++ ++y 
  Sopen12g023800.1 344 NLQINRLENYPLQNLDSQVINSSPDEILVICAQFRLHNLK---HNNPDERTELLKRLKSLEPKGLVLSENNMDCscNScGDFTTRFSRRVDYL 433
                       ******9888*****************************8...67777789********************8875444259************ PP

              GRAS 265 salfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesg 356
                       ++++ds+++ +    + r +  r++++ e+ +++++ g++    +et+ekW er +++GF    ++++a + a++ll+k++ ++++rv+e++g
  Sopen12g023800.1 434 WKFLDSTSVAY----KGRESEGRRMMEGEAAKALTNMGEM----NETKEKWCERTRSVGFVWKMFGDDAIDRARALLKKYDnNWEMRVDEKDG 518
                       *******8875....4555555555666799999999999....99***********************************9999******** PP

              GRAS 357 slvlgWkdrpLvsvSaWr 374
                       ++ l Wk+ p+ ++S W+
  Sopen12g023800.1 519 CVGLWWKGDPVSFCSLWK 536
                       *****************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098538.03131515IPR005202Transcription factor GRAS
PfamPF035141.3E-71158536IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 541 aa     Download sequence    Send to blast
MIIDETTSDP ISEWLDSPLS YFPSLLDESY SIDDLLDESY SLDDIYEDSW WAPIESINQE  60
IHINNNNNNS LPCFDTSFPV TTASTVSLEP VISRHLPPLD SSKKRKGNDS GYNPKASRKN  120
QNRRINDADT RRTTGHKKAT HKSSTGNNGN NREGRWAEQL LNPCAAAITA GNLNRVQHLL  180
YVLRELSSLN GDANHRLAAR GLQALTYYLS TPCPTSLSSA SAATFASTNP KFFKNSLINF  240
NEISPWFRIP NSIANSSILQ ILGKHDSSRN LHILDIGVSH GVQWPTLLEE LTHRAGGPPP  300
LVRLTVITPT IEDGQQRNSP FVVGPGGYNF SVQLLAFAKA ININLQINRL ENYPLQNLDS  360
QVINSSPDEI LVICAQFRLH NLKHNNPDER TELLKRLKSL EPKGLVLSEN NMDCSCNSCG  420
DFTTRFSRRV DYLWKFLDST SVAYKGRESE GRRMMEGEAA KALTNMGEMN ETKEKWCERT  480
RSVGFVWKMF GDDAIDRARA LLKKYDNNWE MRVDEKDGCV GLWWKGDPVS FCSLWKIDHN  540
T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B4e-3315453684473Protein SHORT-ROOT
5b3h_B2e-3315453630419Protein SHORT-ROOT
5b3h_E2e-3315453630419Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator essential for Nod-factor-induced gene expression. Acts downstream of calcium spiking. May be a target of DMI3, a calcium/calmodulin-dependent protein kinase (CCaMK) (PubMed:15961669). Is essential for Nod factor-elicited expression of ERN1 (PubMed:23077241). {ECO:0000269|PubMed:15961669, ECO:0000269|PubMed:23077241}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not induced after treatment with Sinorhizobium meliloti. {ECO:0000269|PubMed:15961669}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754510.0HG975451.1 Solanum pennellii chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015059538.20.0LOW QUALITY PROTEIN: nodulation-signaling pathway 1 protein-like
SwissprotQ4VYC80.0NSP1_MEDTR; Nodulation-signaling pathway 1 protein
TrEMBLA0A3Q7J9R10.0A0A3Q7J9R1_SOLLC; Uncharacterized protein
STRINGXP_009594760.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49492139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13840.11e-136GRAS family protein
Publications ? help Back to Top
  1. Cerri MR, et al.
    Medicago truncatula ERN transcription factors: regulatory interplay with NSP1/NSP2 GRAS factors and expression dynamics throughout rhizobial infection.
    Plant Physiol., 2012. 160(4): p. 2155-72
    [PMID:23077241]
  2. Tang H, et al.
    An improved genome release (version Mt4.0) for the model legume Medicago truncatula.
    BMC Genomics, 2014. 15: p. 312
    [PMID:24767513]