PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen12g018830.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family SBP
Protein Properties Length: 447aa    MW: 49464.8 Da    PI: 7.9796
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen12g018830.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.33.9e-4293168277
                       -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
               SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                       Cqv+gC +dl+++k+yh+rhkvCe+hsk+++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk++
  Sopen12g018830.1  93 CQVQGCGKDLTSCKDYHKRHKVCEIHSKTAKVIVNGIEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPH 168
                       **************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.109.4E-3389154IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.55690167IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.67E-3992170IPR004333Transcription factor, SBP-box
PfamPF031101.5E-3193166IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 447 aa     Download sequence    Send to blast
MESWSYVSGG KGFVSEESVS VDDGITPCSW SQQGVKVGSQ IRDAFGGEDE SSSKHSSSSF  60
IDLKLGRGRF LDVKNFSLSS TKRNRAGGLT SFCQVQGCGK DLTSCKDYHK RHKVCEIHSK  120
TAKVIVNGIE QRFCQQCSRF HLLAEFDDGK RSCRKRLAGH NERRRKPHTG LHSGRAGKHF  180
QPYSGTRFQG SSFVTSSFIC QDILGGSLLH QPKHDMHDWY KNVKVEHCSD YSPELTMPLT  240
NKHSQPRPLF TSYHTDKHCP ALHDEGTTTI TRSKNNESSN SYLNDIGGSD FVSRSLFHST  300
SIGSEVLNVM DSDYPFQGIS NSGCALSLLS SQSQDSSNYS SVVPPSAHHL ITPRSYNHYN  360
MTQTSECFPG ASPKGSTSTV STIYNLSEVI SAEGQLEHVL RNNCGSLQGS DYVNTKNLLS  420
CEDGTTIDLL QLSSQLHQVE HQRHSMK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-29921661084squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754510.0HG975451.1 Solanum pennellii chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015059772.10.0squamosa promoter-binding-like protein 6
RefseqXP_015059773.10.0squamosa promoter-binding-like protein 6
RefseqXP_015059774.10.0squamosa promoter-binding-like protein 6
TrEMBLM1C4S20.0M1C4S2_SOLTU; Uncharacterized protein
STRINGSolyc12g038520.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51871639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.14e-45SBP family protein