PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen12g006970.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 350aa    MW: 39628.4 Da    PI: 9.1352
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen12g006970.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.62e-52141391128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrF Ptdeel+v+yL+kkv+g++++l ++i e+d+yk++Pw Lp+k++ +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk ++
  Sopen12g006970.1  14 LPPGFRFYPTDEELLVQYLCKKVAGHDFPL-QIIGEIDLYKFDPWVLPSKATFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKVIT 105
                       79****************************.89***************988899*************************************** PP

               NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       s +g++vg+kk Lvfy g+apkg+kt+W+mheyrl
  Sopen12g006970.1 106 S-QGRKVGIKKALVFYVGKAPKGSKTNWIMHEYRL 139
                       9.9999***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.14E-6510163IPR003441NAC domain
PROSITE profilePS5100560.43114163IPR003441NAC domain
PfamPF023653.4E-2615139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MGVQEKDPLL QLSLPPGFRF YPTDEELLVQ YLCKKVAGHD FPLQIIGEID LYKFDPWVLP  60
SKATFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKVITSQGRK VGIKKALVFY  120
VGKAPKGSKT NWIMHEYRLF ESSRKNNGSS KLDEWVLCRI YKKNSSGPKP LMSGLHSSNE  180
YSHGSSTSSS SQFDDMLESL PEMDHRFSNL PRLNSLKAEK FNLDRLDSAN FDWAILAGLK  240
PMPESGPANQ APGVQGPAQG HVNNHIHNNN NNSMNFLNDV YADPPNFRGN TKVESINLDE  300
EVESGNRNQR IDQASYFQQS LNGFSQTYTK NVDQFGIQCP NQRLNLGFRQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-10511694171NO APICAL MERISTEM PROTEIN
1ut4_B1e-10511694171NO APICAL MERISTEM PROTEIN
1ut7_A1e-10511694171NO APICAL MERISTEM PROTEIN
1ut7_B1e-10511694171NO APICAL MERISTEM PROTEIN
4dul_A1e-10511694171NAC domain-containing protein 19
4dul_B1e-10511694171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in abscisic acid-mediated stomatal closure (PubMed:25005917). Regulates the expression of NCED1, a gene involved in the biosynthesis of abscisic acid (ABA) (PubMed:25005917). Required for the stomatal closure induced by the bacterial pathogen Pseudomonas syringae pv tomato DC3000, but not for stomatal reopening (PubMed:25005917). {ECO:0000269|PubMed:25005917}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by abscisic acid (ABA), dehydration and wounding. {ECO:0000269|PubMed:25005917}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0115550.0AF011555.1 Lycopersicon esculentum jasmonic acid 2 (LEJA2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015059411.10.0NAC domain-containing protein 72
SwissprotQ9SQL00.0JA2_SOLLC; NAC domain-containing protein JA2
TrEMBLM1B8M10.0M1B8M1_SOLTU; Uncharacterized protein
STRINGSolyc12g013620.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31222452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.21e-121NAC family protein
Publications ? help Back to Top
  1. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]