PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen12g006170.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 283aa    MW: 32221.7 Da    PI: 4.9884
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen12g006170.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.25.6e-11156199548
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                       kr +r   NR +A+rsR RK++++ eLe+ v +L+ae + L  +
  Sopen12g006170.1 156 KRIKRILANRQSAQRSRVRKLQYVSELERSVTTLQAEVSVLSPR 199
                       899*********************************98877655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.1E-14152216IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.565154206IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.73E-11156210No hitNo description
PfamPF001701.3E-9156200IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.0E-13156207No hitNo description
CDDcd147031.98E-21157207No hitNo description
PROSITE patternPS000360159174IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MENLAPSAHN LWADEFLDMS SRRGSHRRSM SDSIAFLESP MVEECRRLSS TTPGSGGTTN  60
GHDEFERFDD EQQIMSMFND DVHDMSCSNP SSPSDYINVN EDKKMNGPDQ MMMQLKSDQN  120
EEVESSCKTN EELATANQNA STNNNEYSSE RVVDPKRIKR ILANRQSAQR SRVRKLQYVS  180
ELERSVTTLQ AEVSVLSPRV AFLDHQRLLL NVDNSALRQK IAALAQDKLF KDAHQEALKV  240
EIERLRQIYY QQNMKQQMDN NNTTPLADST STPPEIKVQL SVN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754510.0HG975451.1 Solanum pennellii chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015059519.10.0PREDICTED: basic leucine zipper 34-like
SwissprotQ9M2K41e-87BZP61_ARATH; Basic leucine zipper 61
TrEMBLK4DCG70.0K4DCG7_SOLLC; Uncharacterized protein
STRINGSolyc12g010800.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17752465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.13e-67bZIP family protein