PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen12g001320.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRAS
Protein Properties Length: 558aa    MW: 62502.8 Da    PI: 5.4965
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen12g001320.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS414.21.2e-1261885571373
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                       l++lL++cA+a+++++l   + l+a+ +  +s +gdp+qRl ay++e+L ar   s++++y++l+++e +    ++ ++++ +++e++P+lkf
  Sopen12g001320.1 188 LKQLLIACARALAENKLDDFEILVAKARSVVSVTGDPIQRLGAYIVEGLVARKELSGTTIYRSLKCKEPA---GKDLFSYMYILYEICPYLKF 277
                       689***************************************************9**************9...99999999************ PP

              GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvak 184
                       ++++aN aI+ea  +e+r+HiiDf++ qG+QW++LlqaLa+Rp+g+p +RiTg+++p s+  + + l ++++rL+ + ee+++ +ef++ v  
  Sopen12g001320.1 278 GYMAANGAIVEACRNEDRIHIIDFQMAQGTQWMTLLQALAARPGGAPYVRITGIDDPVSQyaRGDGLAAVARRLSAISEEFNIAVEFHA-VPV 369
                       *********************************************************999999**************************.688 PP

              GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                          +++ ++L+v+pgEalaVn+ lqlh+++desv+++++rd +++++kslsPk+v++veqe+++n+++Fl rf+eal+yy a+f+s++++l r
  Sopen12g001320.1 370 FAPEITWDMLDVRPGEALAVNFPLQLHHTPDESVDVNNPRDGLIRMIKSLSPKIVTLVEQESNTNTAPFLPRFVEALDYYHAMFESIDVTLQR 462
                       89999**************************************************************************************** PP

              GRAS 278 eseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsv 370
                       + +eri+vE+++l+r+ivnvvaceg+er+erhe l+kW++r+++aGF+++pls+++++ +k l+++++ + y++ e++g+++lgWk+r+Lvs+
  Sopen12g001320.1 463 DMKERINVEQHCLARDIVNVVACEGKERVERHELLGKWKSRFMMAGFQQYPLSSYVNSVIKDLMKRYS-EHYTLVEKDGAMLLGWKERNLVSA 554
                       ********************************************************************.55********************** PP

              GRAS 371 SaW 373
                       SaW
  Sopen12g001320.1 555 SAW 557
                       *** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.966162539IPR005202Transcription factor GRAS
PfamPF035144.1E-124188557IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 558 aa     Download sequence    Send to blast
MDSHHLVAYG VTGSDLSYSS YPTVSPLENR PFGTSKFESG NSPLVNYFNS ETFNTVSDYQ  60
EQPSCTENLS GASSSSGSSL DYNQYFHRPS PSEDHLPEAP YSRNMKHTLL QLESALMGPD  120
EEAMKSSPYI GENMGAQTSG QRYKAWNKEA QVVRHQQSVV SILNGIQSDK RDNVMEDLPL  180
QGVPSSNLKQ LLIACARALA ENKLDDFEIL VAKARSVVSV TGDPIQRLGA YIVEGLVARK  240
ELSGTTIYRS LKCKEPAGKD LFSYMYILYE ICPYLKFGYM AANGAIVEAC RNEDRIHIID  300
FQMAQGTQWM TLLQALAARP GGAPYVRITG IDDPVSQYAR GDGLAAVARR LSAISEEFNI  360
AVEFHAVPVF APEITWDMLD VRPGEALAVN FPLQLHHTPD ESVDVNNPRD GLIRMIKSLS  420
PKIVTLVEQE SNTNTAPFLP RFVEALDYYH AMFESIDVTL QRDMKERINV EQHCLARDIV  480
NVVACEGKER VERHELLGKW KSRFMMAGFQ QYPLSSYVNS VIKDLMKRYS EHYTLVEKDG  540
AMLLGWKERN LVSASAWF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-631855571374GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtMay play a regulatory role in the early step of oligosaccharide elicitor response, downstream of the membrane-associated high-affinity chitin-binding protein. {ECO:0000269|PubMed:12591613}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By oligosaccharide elicitor (N-Acetylchitooligosaccharide) extracted from the rice blast fungus (M.grisea) cell wall. Strongest induction by chitin oligomer with greater degree of polymerization (heptamer). By inoculation of M.grisea in rice cell suspension culture. {ECO:0000269|PubMed:12591613}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754510.0HG975451.1 Solanum pennellii chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015059336.10.0scarecrow-like protein 21
SwissprotQ69VG10.0CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1
TrEMBLG8Z2670.0G8Z267_SOLLC; Hop-interacting protein THI039
STRINGSolyc12g005340.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA34412448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.21e-173GRAS family protein
Publications ? help Back to Top
  1. Day RB, et al.
    Two rice GRAS family genes responsive to N -acetylchitooligosaccharide elicitor are induced by phytoactive gibberellins: evidence for cross-talk between elicitor and gibberellin signaling in rice cells.
    Plant Mol. Biol., 2004. 54(2): p. 261-72
    [PMID:15159627]