PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen11g007250.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRAS
Protein Properties Length: 542aa    MW: 60641.5 Da    PI: 5.4825
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen11g007250.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS421.85.7e-1291735422374
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                       +elL +cAeavs+ d + a+al++ l++++s +g+pm+Rl ay++e+++arl++s+s +yk+l+++e +    se l+++++ ++++P++kf+
  Sopen11g007250.1 173 KELLDACAEAVSDADISTAEALMSALEQRVSVSGEPMERLGAYVLEGIRARLLSSGSIIYKKLKCKEPT---GSELLSYMQVIFNMCPYYKFA 262
                       78999***************************************************************9...9******************** PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                       ++ aN  I ea+ +e+r+HiiDf+i qG QW+ Ll+ La Rp+gpp +RiTgv+++es   +   l+ +gerLa++A+++gvpfef+  +a +
  Sopen11g007250.1 263 YMSANVIIREAMMNENRIHIIDFQIAQGSQWMFLLHDLAHRPGGPPFVRITGVDDEESAyaRGGGLQLVGERLAEVAKSCGVPFEFHG-AALS 354
                       *******************************************************999899999************************.8999 PP

              GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpre 278
                         +++le+Lrvk+gEalaVn+ ++lh+++desvs+ ++rd++L+lvkslsPk+v++veqe+++n+++Fl rf e+l+yy+a+f+s++a  pr+
  Sopen11g007250.1 355 GCEVQLENLRVKHGEALAVNFPYMLHHMPDESVSTINHRDRLLRLVKSLSPKIVTLVEQESNTNTAPFLPRFRETLDYYTAMFESIDAARPRD 447
                       ********************************************************************************************* PP

              GRAS 279 seerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvS 371
                       ++eri+ E+++++r++vn++acega+r+erhe ++kWr rl++aGF++ ++s ++ +++k++l++++ + yr  e++g+l+lgWk+r+L + S
  Sopen11g007250.1 448 DKERISAEEHCVARDVVNIIACEGADRVERHELFGKWRLRLMMAGFTQCQMSPSVGETIKHMLKEYNPN-YRYAESEGALYLGWKNRALATSS 539
                       *******************************************************************55.*********************** PP

              GRAS 372 aWr 374
                       aWr
  Sopen11g007250.1 540 AWR 542
                       **8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.401146523IPR005202Transcription factor GRAS
PfamPF035142.0E-126173542IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010200Biological Processresponse to chitin
Sequence ? help Back to Top
Protein Sequence    Length: 542 aa     Download sequence    Send to blast
MQASQRTQMS GSVHGLYNQQ MQQVEQYYAP YNVLKNSCKD SRSSGMQFSF QAQDEQFFTL  60
DSSPATDYVV NDSPPALSVS SNRSPFSPQC SQSYMSDLHH SSDNTCGSPL SGCSGIDDGD  120
LRHVLRELEN KLLGPESDTD DSCSCSLNDM VSKPSSITRW NRVLDMAPSL NLKELLDACA  180
EAVSDADIST AEALMSALEQ RVSVSGEPME RLGAYVLEGI RARLLSSGSI IYKKLKCKEP  240
TGSELLSYMQ VIFNMCPYYK FAYMSANVII REAMMNENRI HIIDFQIAQG SQWMFLLHDL  300
AHRPGGPPFV RITGVDDEES AYARGGGLQL VGERLAEVAK SCGVPFEFHG AALSGCEVQL  360
ENLRVKHGEA LAVNFPYMLH HMPDESVSTI NHRDRLLRLV KSLSPKIVTL VEQESNTNTA  420
PFLPRFRETL DYYTAMFESI DAARPRDDKE RISAEEHCVA RDVVNIIACE GADRVERHEL  480
FGKWRLRLMM AGFTQCQMSP SVGETIKHML KEYNPNYRYA ESEGALYLGW KNRALATSSA  540
WR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A6e-5917954126378Protein SCARECROW
5b3h_A5e-5917954125377Protein SCARECROW
5b3h_D5e-5917954125377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that acts as a positive regulator of continuous red light signals downstream of phytochrome B (phyB). Required for the regulation of hypocotyl elongation during de-etiolation. May be required to modulate phytochrome A (phyA) signal transduction in a phyB-independent way. {ECO:0000269|PubMed:16680434}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By osmotic and cold stresses, and UV-A/B. {ECO:0000269|PubMed:16680434}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754500.0HG975450.1 Solanum pennellii chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015059104.10.0scarecrow-like protein 13
SwissprotQ9M0M50.0SCL13_ARATH; Scarecrow-like protein 13
TrEMBLA0A3Q7IRV00.0A0A3Q7IRV0_SOLLC; Uncharacterized protein
STRINGSolyc11g012510.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68124111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17230.10.0SCARECROW-like 13