PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen10g031850.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 348aa    MW: 38194.9 Da    PI: 9.2236
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen10g031850.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.96.8e-16278320547
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 
                       +r++r++kNRe+A rsR+RK+a++ eLe+kv  Le+eN++Lk 
  Sopen10g031850.1 278 RRQKRMIKNRESAARSRARKQAYTHELENKVSRLEEENERLKR 320
                       79*************************************9993 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1708.5E-16269321No hitNo description
SMARTSM003381.8E-14274346IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.634276321IPR004827Basic-leucine zipper domain
PfamPF001706.0E-13278321IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.19E-11278323No hitNo description
CDDcd147077.71E-25278323No hitNo description
PROSITE patternPS000360281296IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MGSQGGGGGG GGGVGVNSIG VTQAQAQAHA QDPKTNALAR QGSLYSLTLD EVQNQLGDLG  60
KPLSNMNLDE LLKTVWTVEA SQGMGGTDYG VLQHGQDASG SSLNRQSSIT LTSDLSKKTV  120
DQVWQDIQQG HKRDRIDRKA QERQPTLGEM TLEDFLVKAG VVAESTPGKK SLGSVLGVDS  180
MALPQQQAQW SQYQMQAMHP LPPQQHQQQQ QNMLPVFMPG HSVQQPLTIV SNPTIDAAYP  240
ESQMTMSPTA LLGTLSDTQT LGRKRVAPDD VVEKTVERRQ KRMIKNRESA ARSRARKQAY  300
THELENKVSR LEEENERLKR QKEIEQVLPS VPLPEPKYQL RRTSSAPF
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00409DAPTransfer from AT3G56850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754490.0HG975449.1 Solanum pennellii chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015088864.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
SwissprotQ9LES31e-98AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLK4D3220.0K4D322_SOLLC; Uncharacterized protein
STRINGSolyc10g081350.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA33342448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.11e-96ABA-responsive element binding protein 3