PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen10g028950.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 822aa    MW: 88428.9 Da    PI: 6.3214
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen10g028950.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_139.98.9e-13338398262
                       XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                       ++ k+  r+++NRe+A  sRqRKk ++eeLe+kv  + +  ++L  +++    e  +lk++
  Sopen10g028950.1 338 EDEKKMARLIRNRESAHLSRQRKKHYVEELEDKVRIMHSTIQDLNAKISYVMAENLTLKTQ 398
                       5679999****************************************99999998888876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.6E-14337401IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.737339399IPR004827Basic-leucine zipper domain
PfamPF001704.1E-11340398IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.31E-12341399No hitNo description
Gene3DG3DSA:1.20.5.1705.1E-15341399No hitNo description
CDDcd147047.89E-18342392No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042538Biological Processhyperosmotic salinity response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 822 aa     Download sequence    Send to blast
MSDQPPPVDE NLTGEFDGLA VPPLDHTFFV QHITEADQGI GDDFPMEFRS VDFSIDDVDF  60
DVSFDDFFPN PVDGDAFQKP NCLADCIGSE PGQMDFGQHG SQLIGSFDDA SGIFKSTSGD  120
SLEEAPGSNS VQMDPNCFGQ SGSQLIGNSV DSSTNVKLKL EEMSDISGNQ ATGGVMVMDT  180
SSPEIGQRSS SSRLSNEVSP SLPQISTDVS GYLNVPSPES NGSNHDVSRE SSNDKKGLSD  240
AKVLNCHSPE SQGSGNCGGL NYLSDSNKSV HSSPNLGSNS VKGGTVEHKF KLEGVSANIS  300
NCSSSLLKRK KGGEDLNNAS KHQKSSMFSL SDNVNNDEDE KKMARLIRNR ESAHLSRQRK  360
KHYVEELEDK VRIMHSTIQD LNAKISYVMA ENLTLKTQLG GTGVPPQVQP PPGMYPHPSM  420
VYPWMSYPPP YMMKPQGSQV PLVPIPKLKP QAAAPAPKST KKGEKKKSEV KTKKVASISL  480
LGVLFFMLLF GGLVPLLNVR YGGTREPFLG GFSVGSGFYE KHHGRVLVVD GPVNGTGYSG  540
KYSEKDYSSH CGRGDHSESN QQNTYKAADE FVHMGNGSNP LAASLYVPRN DKLVKIDGNL  600
IIQSVLASEK AMASHGGSDK NNRETGLAVP GDLAPAIPGS HPRLYRSSAV GQRALGTVEK  660
ENVQSTMQQW YLEGVAGPLM SSGMCTEVFQ FDVLSSAPGA IVRATNGRNI SMEQRQNATR  720
IHRNRRILNG PPVSLSRPSH NFSEEQSGTT GKQENFTGNK SLSSMVVSVL VDPREAGDAD  780
GDGIMGPKSL SRIFVVVLID SVKYVTYSCM LPFKAAAPLV TT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1714725RQNATRIHRNRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754490.0HG975449.1 Solanum pennellii chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015055645.10.0PREDICTED: bZIP transcription factor 17
SwissprotO222081e-137BZP17_ARATH; bZIP transcription factor 17
TrEMBLM1AAQ50.0M1AAQ5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000184860.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30292450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.11e-110bZIP family protein