PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen10g028610.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 324aa    MW: 36206.8 Da    PI: 7.2378
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen10g028610.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_152.51.1e-16254296547
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 
                       +r++r++kNRe+A rsR+RK+a++ eLe+kv  Le+eN++Lk 
  Sopen10g028610.1 254 RRQKRMIKNRESAARSRARKQAYTHELENKVSFLEEENERLKR 296
                       79**************************************994 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.0E-13250318IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.45252297IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.5E-14254297No hitNo description
PfamPF001708.1E-14254297IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.19E-11254299No hitNo description
CDDcd147071.68E-24254299No hitNo description
PROSITE patternPS000360257272IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MVIQGMGSRG GGEAKANALA TQGSLYSLTL DEVRNQLGNC GKPLNSMNLD EFVKTVWTIE  60
SNQEVVGGND YGPVQQGASQ HHPSSITMSR DLSKKTVDEV WQDIQQGVKI DNVDKRSQER  120
QLTLGEITLE DFLVKAGVIA ESTQGKRISG LVFGVDSMSL TQQAQWPHYQ IPAMQQVPEQ  180
QHQQQQQNIP PVFMPGHPIQ QPLPVVANPI MDATYPETQV TMSPAHIIGT LSDTQTSGRK  240
RVAPRDVAEN SVERRQKRMI KNRESAARSR ARKQAYTHEL ENKVSFLEEE NERLKRQKEI  300
EDILPTVPPP EPKYQLRRTS SGPI
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754490.0HG975449.1 Solanum pennellii chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015089048.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
RefseqXP_015089047.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
RefseqXP_015089046.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
RefseqXP_015089045.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
SwissprotQ9LES39e-93AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLM1AAW10.0M1AAW1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000185740.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA33342448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.13e-93ABA-responsive element binding protein 3