PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen10g027150.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRAS
Protein Properties Length: 823aa    MW: 89805.4 Da    PI: 6.3445
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen10g027150.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS413.22.4e-1264458042374
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                        +lLl+cAeavs+++le+a+++L ++sel++p g++ qR+aayf eA++arl++s+ ++y+alp+++ +   +++ ++a+++f+ +sP++kfs
  Sopen10g027150.1 445 LTLLLQCAEAVSADNLEEANKMLLEVSELSTPFGTSAQRVAAYFSEAMSARLLNSCLGIYAALPMTSVPMLYTQKMASAFQVFNGISPFIKFS 537
                       579*****************************************************************9888********************* PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrle 187
                       h+taNqaI ea+e+e+rvHiiD+di+qGlQWp L++ LasRp+gpp +R+Tg+g     s ++le+tg+rL++fAe+lg+pfef + va+++ 
  Sopen10g027150.1 538 HFTANQAIQEAFEREDRVHIIDLDIMQGLQWPGLFHILASRPGGPPYVRLTGLGT----SMDALEATGKRLSDFAERLGLPFEFLP-VADKVG 625
                       *******************************************************....***************************.7***** PP

              GRAS 188 dleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklprese 280
                       +l++e+L+v+++Ea+aV++    h+l+d ++s ++    +L+l+++l Pkvv+vveq+++h ++sFl rf+ea++yysalfdsl a +++ese
  Sopen10g027150.1 626 NLDPEKLNVSKREAVAVHWLQ--HSLYDVTGSDSN----TLSLLQRLAPKVVTVVEQDLSH-AGSFLGRFVEAIHYYSALFDSLGACYGEESE 711
                       ********************9..999999999999....**********************.899**************************** PP

              GRAS 281 erikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                       er++vE++ll++ei+nv+a  g +r  + + +++Wre+l+++GF++++l  +aa+qa lll +++s+gy++ e++g+l lgWkd  L+++SaW
  Sopen10g027150.1 712 ERHVVEQQLLSKEIRNVLAVGGPSRSGDAK-FNNWREKLQQSGFRSLSLAGNAAAQATLLLGMFPSHGYTLVEDNGTLKLGWKDLCLFTASAW 803
                       ***********************9777766.************************************************************** PP

              GRAS 374 r 374
                       r
  Sopen10g027150.1 804 R 804
                       8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.997418784IPR005202Transcription factor GRAS
PfamPF035148.2E-124445804IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009630Biological Processgravitropism
GO:0009956Biological Processradial pattern formation
GO:0048366Biological Processleaf development
GO:0051457Biological Processmaintenance of protein location in nucleus
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 823 aa     Download sequence    Send to blast
MAKALPVSGE NCTGVNVVGD SSGEKTSKEL FHCENGKMVR KRAASDMEIQ TGAGEEHRYL  60
RRPAMIGGSH SQVGDSRVCG NSNFGHGMNS NLTMTTQVSN YSTMQMLPSS TNLCGVTSRG  120
GPGIDTGFSN STPNLTYTDA ITSHHQPQGT QTQNNNNQSP SVCVFSGLPL FPPDRNRQNS  180
GLLLQQPPAA AAAVVSSPLT TGRIDSMEDS TSATAWIDSI IKDLINSSAQ VSVPQLIQNV  240
REIIHPCNPY LASLLEYRLR SLTSNNNGGA DQHDPMECWR RKESLPPQLA GLQQAQNNAN  300
LLQHNILSLP DSSNNQYLNW DIALPNSHNA PVAPSLNQHQ QLGGNNPTAT DLSFVTLSPQ  360
VQQQQQQQQQ QESPHSHSQQ QAAVDLEQQQ KQQQSSSSLS PTSVADNSAK TKTSTPAPPV  420
PINTYREKKE EERQQKRDEE GLHLLTLLLQ CAEAVSADNL EEANKMLLEV SELSTPFGTS  480
AQRVAAYFSE AMSARLLNSC LGIYAALPMT SVPMLYTQKM ASAFQVFNGI SPFIKFSHFT  540
ANQAIQEAFE REDRVHIIDL DIMQGLQWPG LFHILASRPG GPPYVRLTGL GTSMDALEAT  600
GKRLSDFAER LGLPFEFLPV ADKVGNLDPE KLNVSKREAV AVHWLQHSLY DVTGSDSNTL  660
SLLQRLAPKV VTVVEQDLSH AGSFLGRFVE AIHYYSALFD SLGACYGEES EERHVVEQQL  720
LSKEIRNVLA VGGPSRSGDA KFNNWREKLQ QSGFRSLSLA GNAAAQATLL LGMFPSHGYT  780
LVEDNGTLKL GWKDLCLFTA SAWRPNSLHA APGSRHFSRP NMD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A0.04288073382Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor involved in asymmetric cell division (By similarity). Required for differentiation of endodermis and graviresponses. {ECO:0000250, ECO:0000269|PubMed:16339910}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754490.0HG975449.1 Solanum pennellii chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015089256.10.0protein SCARECROW
RefseqXP_015089257.10.0protein SCARECROW
SwissprotQ2Z2E90.0SCR_IPONI; Protein SCARECROW
TrEMBLA0A3Q7IJC30.0A0A3Q7IJC3_SOLLC; Uncharacterized protein
STRINGSolyc10g074680.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA82582430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.10.0GRAS family protein