PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen10g025280.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 262aa    MW: 28827.5 Da    PI: 7.2361
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen10g025280.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1201.5e-0687130750
                       HHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   7 errkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                        +r  +N+eA r++ ++Kka ++ Lee+v  L   N++L ++l+
  Sopen10g025280.1  87 KKRPLSNKEAVRKYCEKKKAWVASLEEEVVRLRDINQQLLNRLQ 130
                       57889**********************************98886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.0E-581148IPR004827Basic-leucine zipper domain
PfamPF077168.0E-987130IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.4E-1087149No hitNo description
CDDcd146861.87E-887140No hitNo description
SuperFamilySSF579591.13E-588130No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MDDMELEFSS QEVLSSSTFG EIPESSPMNK RFNEILTDVH ACIHAHTCNP PGPHNSHTHT  60
CYHVHTKVVT PPRDDTTAES TAAKVGKKRP LSNKEAVRKY CEKKKAWVAS LEEEVVRLRD  120
INQQLLNRLQ GQAVLEAEVS RLKCLLVDIR GRIAGEIGSF PYHKPMEGAD VYQNLRGTYV  180
MNPCNLQCDD QVYCLQPNSE ESNGQGLDSC GFETLQCSSS QGLKEVPGCA LGFGTPTANT  240
SHGNKKKRTG GKCAHNGKPV NC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754490.0HG975449.1 Solanum pennellii chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015055396.10.0PREDICTED: uncharacterized protein LOC107001964
SwissprotQ8GTS22e-90BZP23_ARATH; Basic leucine zipper 23
TrEMBLK4D1E50.0K4D1E5_SOLLC; Uncharacterized protein
STRINGSolyc10g055550.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29892452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.11e-91bZIP family protein