PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen10g021360.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 411aa    MW: 44825.4 Da    PI: 9.9609
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen10g021360.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.82.3e-13333377549
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkel 49 
                       +r +r++kNRe+A rsR+RK+a++ eLe +v++L++ N++L+k+ 
  Sopen10g021360.1 333 RRHKRMIKNRESAARSRARKQAYTFELEAEVAKLKEINEKLQKKQ 377
                       689**************************************9864 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.4E-11329394IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.185331376IPR004827Basic-leucine zipper domain
CDDcd147075.01E-25333387No hitNo description
SuperFamilySSF579594.5E-10333380No hitNo description
Gene3DG3DSA:1.20.5.1708.3E-14333387No hitNo description
PfamPF001702.0E-11333380IPR004827Basic-leucine zipper domain
PROSITE patternPS000360336351IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 411 aa     Download sequence    Send to blast
MGSYLNFKNC TDTPQIERNG EKSMGSGSFS LTRQSSMYSL TFEELQSTCG FGKDVGSMNL  60
EDLLKNISTA EESQGLASSA GVGEGSMAAG TLQRQGSLTL PRTLNQRTVD EVWRDFQNET  120
TVSSNLGQKQ SNLGEMTLEE FLVRAGVVRD DNQPNGTSNN VGFTGVLGEP SSNNNALNIA  180
FQQPTQSPGL LSKFSESNML NVVNVKSSQQ QPQQQQPLIP KKRNVDFASP MQLGNNCQLA  240
SPTARALVVS TSSRSVNATV VQGGVMQNGV TGMAGLLSGV TFAPGGSPGN QLSSEMISKD  300
KLYRSFLSPS PYAFNEGGRG RKSCSTLEKV VERRHKRMIK NRESAARSRA RKQAYTFELE  360
AEVAKLKEIN EKLQKKQAEF IDSQKNQLLE KMNTSFGSKL RCLRRTLTGP W
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754490.0HG975449.1 Solanum pennellii chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015089552.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform X1
TrEMBLK4D0H70.0K4D0H7_SOLLC; Uncharacterized protein
STRINGSolyc10g050210.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7762497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34000.26e-89abscisic acid responsive elements-binding factor 3