PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen10g004030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 310aa    MW: 34543.7 Da    PI: 9.5194
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen10g004030.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like84.51.1e-2685139156
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                       k +l+WtpeLH++Fv+a+e+L G +kA+P++ilelm  +gLt+++++SHLQkYR +
  Sopen10g004030.1  85 KVKLDWTPELHRKFVKAIEKL-GVDKAVPSRILELMATHGLTRHNIASHLQKYRAH 139
                       5799*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.21382141IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-2583141IPR009057Homeodomain-like
SuperFamilySSF466891.16E-1784142IPR009057Homeodomain-like
TIGRFAMsTIGR015576.9E-2585140IPR006447Myb domain, plants
PfamPF002494.6E-888137IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MLALSSSLSY KNERENYDLF QDFSHGNLID TIDFDDFFDE INGGDLLPDF EFFCEESAIH  60
GNMKSKSKEA KKSSSKIKNP QGKKKVKLDW TPELHRKFVK AIEKLGVDKA VPSRILELMA  120
THGLTRHNIA SHLQKYRAHQ KHLLAREAEA ASLNHKKQMY SEATTIGGGR KRILMNPWPA  180
PPTMGFPPMA HHVRPLHVWG HPHVNNSFWH PHYQRVSNSL APGTPCFPAP ITSARFAAPL  240
MVPGIPPSPA IIKVDTIASD LHPSNESIDA AIEDVLAKPQ LPLPIGLKPP SIDSVLNELQ  300
RQGITKIPPT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A1e-1487141357Transcription factor LUX
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that functions with GLK2 to promote chloroplast development. Acts as an activator of nuclear photosynthetic genes involved in chlorophyll biosynthesis, light harvesting, and electron transport. Acts in a cell-autonomous manner to coordinate and maintain the photosynthetic apparatus within individual cells. May function in photosynthetic capacity optimization by integrating responses to variable environmental and endogenous cues (PubMed:11828027, PubMed:12220263, PubMed:17533111, PubMed:18643989, PubMed:19376934, PubMed:19383092, PubMed:19726569). Prevents premature senescence (PubMed:23459204). {ECO:0000269|PubMed:11828027, ECO:0000269|PubMed:12220263, ECO:0000269|PubMed:17533111, ECO:0000269|PubMed:18643989, ECO:0000269|PubMed:19376934, ECO:0000269|PubMed:19383092, ECO:0000269|PubMed:19726569, ECO:0000269|PubMed:23459204}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By light. Repressed by BZR2. {ECO:0000269|PubMed:12220263, ECO:0000269|PubMed:21214652}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ3164590.0JQ316459.1 Solanum lycopersicum golden2-like protein (GLK2) mRNA, complete cds.
GenBankJX1638970.0JX163897.1 Solanum lycopersicum cultivar Ailsa Craig golden 2-like 2 transcription factor (GLK2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015089237.10.0transcription activator GLK1-like isoform X1
RefseqXP_027767885.10.0transcription activator GLK1-like isoform X1
SwissprotQ9SIV39e-59GLK1_ARATH; Transcription activator GLK1
TrEMBLI6RHK00.0I6RHK0_SOLLC; Golden 2-like 2 transcription factor
STRINGPGSC0003DMT4000562550.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA25322356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.12e-58GBF's pro-rich region-interacting factor 1
Publications ? help Back to Top
  1. Leister D,Kleine T
    Definition of a core module for the nuclear retrograde response to altered organellar gene expression identifies GLK overexpressors as gun mutants.
    Physiol Plant, 2016. 157(3): p. 297-309
    [PMID:26876646]
  2. Nagatoshi Y, et al.
    GOLDEN 2-LIKE transcription factors for chloroplast development affect ozone tolerance through the regulation of stomatal movement.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(15): p. 4218-23
    [PMID:27035938]
  3. Tokumaru M, et al.
    Ubiquitin-Proteasome Dependent Regulation of the GOLDEN2-LIKE 1 Transcription Factor in Response to Plastid Signals.
    Plant Physiol., 2017. 173(1): p. 524-535
    [PMID:27821720]
  4. Ni F, et al.
    Turnip Yellow Mosaic Virus P69 Interacts with and Suppresses GLK Transcription Factors to Cause Pale-Green Symptoms in Arabidopsis.
    Mol Plant, 2017. 10(5): p. 764-766
    [PMID:27964999]
  5. Wang H,Seo JK,Gao S,Cui X,Jin H
    Silencing of AtRAP, a target gene of a bacteria-induced small RNA, triggers antibacterial defense responses through activation of LSU2 and down-regulation of GLK1.
    New Phytol., 2017. 215(3): p. 1144-1155
    [PMID:28656601]