PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen09g033790.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRAS
Protein Properties Length: 121aa    MW: 13638.7 Da    PI: 6.5025
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen09g033790.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS36.28.5e-1243101260
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvsel 60 
                        elL + A+ v+++ + +a++lL+  ++ as +g+p+q+++ yf+ AL++r+ r+++++
  Sopen09g033790.1  43 AELLQASAQLVATRTFDRARKLLSLCNQSASATGTPVQKIVYYFADALQHRIDREMTKM 101
                       5789999**********************************************955544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF035142.9E-943101IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 121 aa     Download sequence    Send to blast
MKITKQRSLN HISQKSDPYS IIFNPLAANS GLSPELLQDL DLAELLQASA QLVATRTFDR  60
ARKLLSLCNQ SASATGTPVQ KIVYYFADAL QHRIDREMTK MLFTGEEDIE VYFLFVYASC  120
C
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754480.0HG975448.1 Solanum pennellii chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015160788.19e-70PREDICTED: scarecrow-like protein 28
TrEMBLA0A0V0H2211e-70A0A0V0H221_SOLCH; Putative ovule protein (Fragment)
TrEMBLM0ZMM48e-68M0ZMM4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000039541e-68(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA85001728