PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen09g005640.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRAS
Protein Properties Length: 761aa    MW: 85861.4 Da    PI: 5.849
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen09g005640.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS375.38e-1153877591374
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                       l++l+++cA+av+++d + a++lL+++++++sp gd +qRla++f+ +L+arla+++s++ykal  ++ts    ++ l+a++l+   sP+ k+
  Sopen09g005640.1 387 LRTLMINCAQAVAADDSRIANELLKQIRQHSSPFGDGNQRLAHCFADGLEARLAGTGSQIYKALVNKRTS---AADLLKAYHLYLASSPFRKI 476
                       57899***********************************************************999998...9******************* PP

              GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvak 184
                       s ++ N++I+  +e+++rvH+iDf+i +G+QWp+++q +a+R++gpp+lRiTg++ p++g   +e++eetg+rLa++A++++vpfe+++ +ak
  Sopen09g005640.1 477 SSFASNKTIMLKAENATRVHVIDFGILYGFQWPTFIQRIAEREGGPPRLRITGIEFPQPGfrPAERIEETGRRLADYARSFNVPFEYHA-IAK 568
                       ***********************************************************9*****************************.7** PP

              GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                       ++e++++e+L+++++E laVn+ ++ ++l+de+ ++es r+ vL+lv++++P+++v+   +  ++++ F++rf eal ++salfd le+ +pr
  Sopen09g005640.1 569 KWESITVEDLKLDKDEFLAVNCLYRFKNLHDETIAVESSRTIVLNLVRKINPDIFVHGIVNGAYSAPFFVTRFREALFHFSALFDILETIVPR 661
                       ********************************************************************************************* PP

              GRAS 278 eseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsek.aakqaklllrkvksdgyrveeesgslvlgWkdrpLvs 369
                       e  er+ +Ere++gre+ nv+aceg er+er et+++W++r++ a F+++p++ +  +++a   +r  + + + ++e+s++l+lgWk+r++++
  Sopen09g005640.1 662 EIPERRLIEREIFGREALNVIACEGWERVERPETYKQWQARIMGARFTQIPFDREeFVNKAIEKVRLGYHRDFVIDEDSQWLLLGWKGRTIYA 754
                       ****************************************************86515677777888888788********************* PP

              GRAS 370 vSaWr 374
                       +S+W+
  Sopen09g005640.1 755 LSCWK 759
                       ****8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.233361738IPR005202Transcription factor GRAS
PfamPF035142.8E-112387759IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 761 aa     Download sequence    Send to blast
MDPRFNGHRS SLNNFRFGNQ PLPFSSEQRM INGPRFGLIY SDQNLLNGPR LENNFVQHDF  60
GAVGFISGDH LPTSVESRTD LGVENDFNED IDFSDAVLSY INRMLMEEDM EDKTDMLQES  120
LELQAKEKSL YEALGKKYPP SPEQNMFTAR NSESPDDYVA GSIYNSTSNT GDSSGYLVDP  180
RGVNISTNCN SSYFEGLSFH NTSSVCSSNS GSNVVDGFLD SPVSSFHIPD IYDESQSILN  240
FQKGVEEASK FLPTSNKLLN SIDINLLPSR EPQRQTAYAA SQVEEKDEGE TSPTEARGKK  300
NPLSGDNNIE EERSSKQAAV FTESTLRSEE FDIVLLNSMG KGGEALEAYQ QNLRNAKSKT  360
TVQISKGSKG GKGRGKKQGG KKEVIDLRTL MINCAQAVAA DDSRIANELL KQIRQHSSPF  420
GDGNQRLAHC FADGLEARLA GTGSQIYKAL VNKRTSAADL LKAYHLYLAS SPFRKISSFA  480
SNKTIMLKAE NATRVHVIDF GILYGFQWPT FIQRIAEREG GPPRLRITGI EFPQPGFRPA  540
ERIEETGRRL ADYARSFNVP FEYHAIAKKW ESITVEDLKL DKDEFLAVNC LYRFKNLHDE  600
TIAVESSRTI VLNLVRKINP DIFVHGIVNG AYSAPFFVTR FREALFHFSA LFDILETIVP  660
REIPERRLIE REIFGREALN VIACEGWERV ERPETYKQWQ ARIMGARFTQ IPFDREEFVN  720
KAIEKVRLGY HRDFVIDEDS QWLLLGWKGR TIYALSCWKP V
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A2e-493707601379Protein SCARECROW
5b3h_D2e-493707601379Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754480.0HG975448.1 Solanum pennellii chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015086283.10.0scarecrow-like protein 9
SwissprotO809330.0SCL9_ARATH; Scarecrow-like protein 9
TrEMBLA0A3Q7IU670.0A0A3Q7IU67_SOLLC; Uncharacterized protein
STRINGSolyc09g010920.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27624191
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.10.0GRAS family protein