PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen09g004520.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 425aa    MW: 47192.4 Da    PI: 5.8324
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen09g004520.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_128.33.9e-0999161163
                       XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                       eke +r  r   NRe+Ar   +R++a  eeL++k++ L++eN  Lkke e   ke+++lk+e+
  Sopen09g004520.1  99 EKEERRLSRVLANRESARQTIRRRQAMYEELTRKAADLSSENNNLKKEKELAAKEYDYLKNEN 161
                       577778888888************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.9E-595159No hitNo description
PfamPF001701.5E-799161IPR004827Basic-leucine zipper domain
SMARTSM003382.1E-999163IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.231101164IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.95E-5103159No hitNo description
CDDcd147022.29E-13104155No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MKDKFTPPCK AVEGKFAGGD GKGELVDFEM EAAQALACLA NPGSRSDEFS VPGPSGRSEE  60
HVITIQSEHE SEPKTSPQHV LNYPPVASRR SRQNLTEEEK EERRLSRVLA NRESARQTIR  120
RRQAMYEELT RKAADLSSEN NNLKKEKELA AKEYDYLKNE NVTLRRQMSR IEKAEAEETD  180
GASRSKPVEI SSTSPTPAPN LTPTPAPTSL FNQPPILPFF WPSIVQPFNL LQCSTQNISD  240
IASVVPLPIA GELNSINRQQ ISNPGNPLYL LPFPCLIPFY PQSNPFLPWA STVTEKHAET  300
SSAHQCSTSY MNMENNQAAT TQETETEAFL GFPPDSCASD RRRQRSREMI PMTGPSGYID  360
THHQQDDDTP DTNALSCTAG HRGDTSEKTS EESITCSSEK TADAIAAATE ARKRRKELLH  420
LKGHH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1411416RKRRKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754480.0HG975448.1 Solanum pennellii chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015086799.10.0PREDICTED: uncharacterized protein DDB_G0284459
TrEMBLK4CR050.0K4CR05_SOLLC; Uncharacterized protein
STRINGSolyc09g009760.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA54171724
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19490.14e-14bZIP family protein