PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen09g004230.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 426aa    MW: 46169 Da    PI: 8.751
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen09g004230.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.24.3e-14342393556
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                       +r+rr++kNRe+A rsR+RK+a++ eLe +  +L++eN  Lk+ l el+ + 
  Sopen09g004230.1 342 RRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENAHLKQALAELERKR 393
                       79*******************************************9999765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.2E-14338402IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.783340392IPR004827Basic-leucine zipper domain
PfamPF001701.8E-12342394IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.0E-14342395No hitNo description
CDDcd147073.42E-24342396No hitNo description
SuperFamilySSF579592.0E-10342392No hitNo description
PROSITE patternPS000360345360IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0010152Biological Processpollen maturation
GO:0010187Biological Processnegative regulation of seed germination
GO:0010200Biological Processresponse to chitin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048316Biological Processseed development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 426 aa     Download sequence    Send to blast
MGVQEPEMVS QSEVQSPLQQ DQNLHKNNPF PSLGRQASIY SLTLDEFQHT VCESGKNFGS  60
MNMDEFLNSI WTAEENQAHA HAQPHCQAAS TGEATSTPRF ALGQGNVSLE KAIVEQPSLP  120
RQGSLTLPAP LCSKTVDEVW SEIHKTQQEQ QQNNGCNIQN TGNGSSTQRQ ATFGEMTLED  180
FLVKAGVVRE QGNSAPAPPQ QQSYMMYPNS ANPTMATMAR PVIGLGGVTG GVGVGVSIPG  240
YPPLPQTGVV EAPVYPMSMK RGSGFPQQPT PVYGGRMGNG SGVGYGQVVQ GVAGMGSPLS  300
PVSSDALCVN QIDSGGQYGL EIGMRGGRKR VLDGPVEKVV ERRQRRMIKN RESAARSRAR  360
KQAYTVELEA ELNQLKEENA HLKQALAELE RKRKQQYFDE AKMKAQTKAQ KANGKLRGMR  420
RSLSCP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00294DAPTransfer from AT2G36270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754480.0HG975448.1 Solanum pennellii chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015087406.10.0PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5
RefseqXP_015087407.10.0PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5
SwissprotQ9SJN01e-117ABI5_ARATH; Protein ABSCISIC ACID-INSENSITIVE 5
TrEMBLK4CQX80.0K4CQX8_SOLLC; Uncharacterized protein
STRINGSolyc09g009490.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61552433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36270.11e-111bZIP family protein