PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen09g002830.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family TCP
Protein Properties Length: 201aa    MW: 21304 Da    PI: 8.0775
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen09g002830.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP114.41.5e-3543120683
               TCP   6 drhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssas 83 
                       ++++++hTkv+gR+RRvR++a+caar+F+L++eLG+ +d++tieWLl++a+pai+++tgt++ +a+++++ s++   s
  Sopen09g002830.1  43 SSSKDRHTKVNGRGRRVRMPALCAARVFQLTKELGHRTDGETIEWLLRNAEPAIIAATGTGTVPATQVTTTSENIPLS 120
                       579*********************************************************999997774433333333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036348.4E-3144123IPR005333Transcription factor, TCP
PROSITE profilePS5136927.3194599IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MGSEIVVSGA ISGVGNGSVN SETNGKTALA VVPTKKRNAL SVSSSKDRHT KVNGRGRRVR  60
MPALCAARVF QLTKELGHRT DGETIEWLLR NAEPAIIAAT GTGTVPATQV TTTSENIPLS  120
QSQPSVLAPL TRATPVSGFP VGGGFFSMTP QSQPNCRLDL CQPSLEFSGN AYRHMPFTAL  180
LLQPVTTDDG EEKVAEEDEK Q
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754480.0HG975448.1 Solanum pennellii chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015086656.11e-147transcription factor TCP11
SwissprotQ9SJK71e-41TCP11_ARATH; Transcription factor TCP11
TrEMBLA0A3Q7HYI71e-144A0A3Q7HYI7_SOLLC; Uncharacterized protein
STRINGSolyc09g008030.1.11e-145(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24824201
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37000.15e-36TCP family protein