PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen08g030870.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ARF
Protein Properties Length: 644aa    MW: 72431.4 Da    PI: 7.688
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen08g030870.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B371.31.3e-22116216198
                       EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
                B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                       f+kvlt sd++++g +++ +k+a+e+      ++++  +++l+ +d++  +W++k+i+r++++r++lt+GW+ Fv++++L +gD++vF +   
  Sopen08g030870.1 116 FCKVLTASDTSTHGGFSVLRKHANEClppldlNQQT-PTQELIAKDLHDVEWRFKHIFRGQPRRHLLTTGWSTFVSSKKLVAGDSFVFLR--G 205
                       99****************************973333.3459************************************************3..3 PP

                       SEE..EEEEE- CS
                B3  88 sefelvvkvfr 98 
                       ++++l+v+v r
  Sopen08g030870.1 206 DNGQLRVGVKR 216
                       77888999865 PP

2Auxin_resp98.87.6e-33242321183
        Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                       a+ha++t+++F v+Y+Pr+  ++F+v v+k+++alk++++vGmRfkm+fe e+ + rr++Gt+vg+ dl++ +W+nS WrsLk
  Sopen08g030870.1 242 ASHAVTTQTMFVVYYKPRT--TQFIVGVNKYLEALKHEYAVGMRFKMQFEAEENPDRRFMGTIVGIDDLSS-QWKNSAWRSLK 321
                       789***************6..9**********************************************777.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.1E-39108231IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.7E-40109245IPR015300DNA-binding pseudobarrel domain
CDDcd100172.06E-20114216No hitNo description
PROSITE profilePS5086311.335116218IPR003340B3 DNA binding domain
PfamPF023621.2E-20116216IPR003340B3 DNA binding domain
SMARTSM010192.6E-21116218IPR003340B3 DNA binding domain
PfamPF065077.4E-31242321IPR010525Auxin response factor
PfamPF023091.9E-7541587IPR033389AUX/IAA domain
SuperFamilySSF542773.14E-11546626No hitNo description
PROSITE profilePS5174521.872550631IPR000270PB1 domain
PfamPF023092.7E-5596636IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 644 aa     Download sequence    Send to blast
MNSSGKKDAL YHELWQLCAG PVVDVPREEE RVYYFPQGHM EQLVASINQE MDQRIPSFNL  60
KSKVLCRVIN SHFLAEEDND EVYVQITLMP EAPHVPEPTT PDPLIPQDVK PRFHSFCKVL  120
TASDTSTHGG FSVLRKHANE CLPPLDLNQQ TPTQELIAKD LHDVEWRFKH IFRGQPRRHL  180
LTTGWSTFVS SKKLVAGDSF VFLRGDNGQL RVGVKRLVRQ QSSMPSSVMS SQSMHLGVLA  240
TASHAVTTQT MFVVYYKPRT TQFIVGVNKY LEALKHEYAV GMRFKMQFEA EENPDRRFMG  300
TIVGIDDLSS QWKNSAWRSL KVRWDEPAAI ARPDRVSPWE IKPYVCSIPN VLVPPTAGKN  360
KRHRLHSEIK ISEQPSSSNA SAVWNPSLRS PQFNTFGINS STNCALASLT ESGWQLPHLN  420
TSGMLVDEPE DGRSAPTWCG FPCVLAPQFG QGTNQPIVIP TDGRKCDTKK TCRLFGIDLK  480
SSSISTTEAR LQPQPAGISC VFAERAPPNT VPAGDSDQKS ELSVDFKDQM QGHLRLPLKE  540
VQSKQSCSTR SRTKVQMQGV AVGRAVDLTI LKGYDELTKE LEEMFEIQGE LQSRQKWGIL  600
FTDDEGDTML MGDYPWQDFC NVVRKIFICS SQDMKKLTLS RADS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-16523436354Auxin response factor 1
4ldw_A1e-16523436354Auxin response factor 1
4ldw_B1e-16523436354Auxin response factor 1
4ldx_A1e-16523436354Auxin response factor 1
4ldx_B1e-16523436354Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0136390.0BT013639.1 Lycopersicon esculentum clone 132441R, mRNA sequence.
GenBankHM0372500.0HM037250.1 Solanum lycopersicum cultivar Zhongshu No. 6 auxin response factor 9 (ARF9) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015083855.10.0auxin response factor 9
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLA0A3Q7HWW70.0A0A3Q7HWW7_SOLLC; Auxin response factor
STRINGSolyc08g082630.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23472450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.10.0auxin response factor 9