PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen08g029720.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family TALE
Protein Properties Length: 616aa    MW: 69458.9 Da    PI: 6.5954
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen08g029720.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.26.8e-093904271954
                       HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  Sopen08g029720.1 390 FEHflHPYPSDVDKHILARQTGLSRSQVSNWFINARVR 427
                       554459******************************88 PP

2BELL115.13.5e-37251319472
              BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                       elqk+k+kLl++leeVd+rYk+y++q++ v+ssFeavag g+a++Y +lA++a+SrhFrcL+d i+ qi
  Sopen08g029720.1 251 ELQKRKTKLLQMLEEVDRRYKHYCDQMKGVVSSFEAVAGNGAATVYSALASRAMSRHFRCLRDGIVAQI 319
                       89*****************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.3E-48192317IPR006563POX domain
PfamPF075261.9E-43198315IPR006563POX domain
PROSITE profilePS5007112.082368431IPR001356Homeobox domain
CDDcd000862.25E-11371432No hitNo description
SMARTSM003895.8E-9371435IPR001356Homeobox domain
SuperFamilySSF466895.56E-17372437IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-27374437IPR009057Homeodomain-like
PfamPF059208.1E-18388427IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 616 aa     Download sequence    Send to blast
MVTSTGYWFS SDTNNQNPTP HNNIVNHQLQ NFETNPDMYN LSSSTTSSMD QMMLGFPPNN  60
NNPHHVLWKG NFLNKINGVD DDDDDDHGPS SSKNISEQFY QHETMLATTT SHQDSWHHDN  120
NRTLLVDDPS MRCVFPCEGN ERPSQGLSLS LCSSNPSSIG LQSFELRHQD LQQGLIHDGF  180
LGKSTSIQQG YFHHHHQVRD SKYLGPAQEL LSEFCSLGIK KNNDHSSSKL LLKQHDSTSK  240
KQLLQSLDLL ELQKRKTKLL QMLEEVDRRY KHYCDQMKGV VSSFEAVAGN GAATVYSALA  300
SRAMSRHFRC LRDGIVAQIK ATKMAMGEKD STTTLIPGST RGETPRLRLL DQTLRQQKAF  360
QQMNMMETHP WRPQRGLPER SVSVLRAWLF EHFLHPYPSD VDKHILARQT GLSRSQVSNW  420
FINARVRLWK PMVEEMYLEE TKEEEEENVG SQDGSKALID EMTINNHQSS HTDQKPNLVR  480
IESECISSII NHHPHDKNDQ NYGVIRGGDQ SFGAIELDFS TNIAYATNGS DHHHGGGGGS  540
GGVSLTLGLQ QHGGSSMGLT TFSSQPSHHN HNHQSSIFYP RDDHDQVQYS SLLDSENQNL  600
PYRNLMGAQL LHDLAG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-15377435563Homeobox protein Meis2
3k2a_B1e-15377435563Homeobox protein Meis2
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ2612420.0GQ261242.1 Solanum lycopersicum cultivar Rio Grande PtoR Hop-interacting protein THI035 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015085556.10.0PREDICTED: homeobox protein BEL1 homolog
SwissprotQ388971e-141BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLK4CPD70.0K4CPD7_SOLLC; Uncharacterized protein
STRINGSolyc08g081400.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53001317
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-100TALE family protein