PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen08g027270.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRAS
Protein Properties Length: 701aa    MW: 76606.2 Da    PI: 6.1608
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen08g027270.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS280.45.3e-863407003374
              GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                       ++++++ e + +g++++aq +Larl+++ sp g+p +R+a+y++eAL+   +   + ++  lpp++ ++ + + ++ a+k+fse+sP+++f +
  Sopen08g027270.1 340 DQIFQASELLLAGQFSNAQMILARLNQQLSPIGKPSRRAAFYIKEALQLPFLL--PCTSTFLPPRSPTPFDCVLKMDAYKAFSEISPLIQFMN 430
                       57899999999*************************************99998..566666899999999*********************** PP

              GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrle. 187
                       +t NqaIlea+  +e++HiiDfdi+ G+QW +++q+L s ++++ sl+iT+++sp+++++ e+  ++e L++fA+  g++fe +v+  ++++ 
  Sopen08g027270.1 431 FTSNQAILEALGDAEQIHIIDFDIGFGAQWSSFMQELPSSNRKATSLKITAFASPSTHHSVEIGIMHESLTQFANDAGIRFELEVINLDSFDp 523
                       *************************************************************************************97775541 PP

              GRAS 188 .dleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                        +  l++Lr ++ Ea+a+n+ +   +    + + +s    +L+++k+lsPkvvv  e+ +++ + ++ +++++al+yy +l+ s++a    + 
  Sopen08g027270.1 524 kSYPLSTLRSSECEAIAINFPIWSISSC--PFAFPS----LLHCMKQLSPKVVVSLERGCERIELPLKHHLIHALQYYETLLASIDAA-NITP 609
                       155678999999********99655554..666666....*********************************************666.4677 PP

              GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSa 372
                       +  +k+Er l++++i+n++  + ++      ++  Wr+ + +aGF+pv++s+ ++ qa+++++++++ g++v++++ slvl+Wk+++L+s+  
  Sopen08g027270.1 610 DIGKKIERSLFQPSIENMILGRLRS----SDRMPPWRNLFASAGFSPVAFSNMTEIQAECVVKRTQVGGFHVQKRQTSLVLCWKQQELLSAVT 698
                       9999****************99888....78899*********************************************************** PP

              GRAS 373 Wr 374
                       Wr
  Sopen08g027270.1 699 WR 700
                       *8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.277312680IPR005202Transcription factor GRAS
PfamPF035141.8E-83340700IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 701 aa     Download sequence    Send to blast
MIVIPQSNNL PAKGVLGVSG FVPSISSSSS PEASICKKDA NFTRNEPVSV LDTRSPSPSA  60
SSSSCSYGAQ HGGNTAVPGV GSGKTDGRKE ELVTELEPFT VGLEPEKSVL GFGDLDNLLP  120
EFAGSDQSFL RWISGDLEDP SVSLKQLLNG DLGCGVSLQS SGFEVSATGS LAHSDNVSFS  180
GSNICLNANI EKLSSVIDSL NSRNNNFENP NVNPSLEQKP QPFGPQVMAN QTQFQNAACV  240
NIFGSSSYDI NQEQPPPKRH NSGTLGGALL PKVPFFDANC DFMLRKQPLG QMQPQVNLLP  300
PHQFQPKPLI VPKLEAAGGG GNGNLMVPRH QLQEQQFIYD QIFQASELLL AGQFSNAQMI  360
LARLNQQLSP IGKPSRRAAF YIKEALQLPF LLPCTSTFLP PRSPTPFDCV LKMDAYKAFS  420
EISPLIQFMN FTSNQAILEA LGDAEQIHII DFDIGFGAQW SSFMQELPSS NRKATSLKIT  480
AFASPSTHHS VEIGIMHESL TQFANDAGIR FELEVINLDS FDPKSYPLST LRSSECEAIA  540
INFPIWSISS CPFAFPSLLH CMKQLSPKVV VSLERGCERI ELPLKHHLIH ALQYYETLLA  600
SIDAANITPD IGKKIERSLF QPSIENMILG RLRSSDRMPP WRNLFASAGF SPVAFSNMTE  660
IQAECVVKRT QVGGFHVQKR QTSLVLCWKQ QELLSAVTWR C
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A3e-2734469925378Protein SCARECROW
5b3h_A3e-2734469924377Protein SCARECROW
5b3h_D3e-2734469924377Protein SCARECROW
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754470.0HG975447.1 Solanum pennellii chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015085599.10.0scarecrow-like protein 22
RefseqXP_015085600.10.0scarecrow-like protein 22
TrEMBLA0A3Q7IP280.0A0A3Q7IP28_SOLLC; Uncharacterized protein
STRINGPGSC0003DMT4000121040.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA69861931
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-100GRAS family protein