PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen08g023460.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 375aa    MW: 41884.7 Da    PI: 6.1509
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen08g023460.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_124.84.6e-08130191162
                       XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                       ek+ k+  ++++ R+ +r++R R+k ++e+Le+ v ++++  ++L   +++l+ e a+lk++
  Sopen08g023460.1 130 EKDEKKKSKLERDRVNSRAYRNRRKHYVEKLEDDVRTMQSTIQELSRMISHLTLENATLKTQ 191
                       7899*******************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.4E-9126192No hitNo description
SMARTSM003382.4E-6130194IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.967132195IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.92E-7134192No hitNo description
SuperFamilySSF549281.75E-27282371IPR012677Nucleotide-binding alpha-beta plait domain
Gene3DG3DSA:3.30.70.3301.9E-25288370IPR012677Nucleotide-binding alpha-beta plait domain
PROSITE profilePS5010218.172292370IPR000504RNA recognition motif domain
SMARTSM003609.1E-25293366IPR000504RNA recognition motif domain
CDDcd124081.16E-39293368No hitNo description
PfamPF000763.2E-19294360IPR000504RNA recognition motif domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0000166Molecular Functionnucleotide binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MENSDKPLEN DSSGVPVPPP DDGINNDSNM ESAGQKDEVM LDDVETEIDL SIDDVFPPPD  60
VEYLNESPES SNRKASMESG NVKCGVVAEQ EIRLKDLKRK KVSDDSNNAF KHEKSEFVVD  120
GSNIRNLSSE KDEKKKSKLE RDRVNSRAYR NRRKHYVEKL EDDVRTMQST IQELSRMISH  180
LTLENATLKT QMGSTSQIPP PHGMNPHHTI RSPWMFDAPP YMARPQGSQA PHIVIKPIPR  240
KPQAVAPPTS RETPAAGAGS HKSAYFAPIM TGGASTSRSG EGTEMRRRND ENSVRVTNIS  300
ENTREADLLE LFCPFGHVNG VYVAIDQNTG MSRGFGFVNF VNREDAERAI NKLNGHSYHN  360
LILRVEWAAP SVFFP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cq0_A1e-27279372396Eukaryotic translation initiation factor 3 su
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754470.0HG975447.1 Solanum pennellii chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015084839.10.0PREDICTED: bZIP transcription factor 17-like
TrEMBLK4CMK40.0K4CMK4_SOLLC; Uncharacterized protein
STRINGSolyc08g074860.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1861444
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56660.11e-18basic region/leucine zipper motif protein 49