PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen08g007600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 416aa    MW: 45348.3 Da    PI: 5.122
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen08g007600.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1482.7e-15214270359
                       XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 
                       ++kr rr+ +NRe+ArrsR+RK+a + eLe+ v +   eN++L k+l  +++++ + 
  Sopen08g007600.1 214 DVKRVRRMLSNRESARRSRRRKQAHLTELETQVSQVRVENSSLLKRLTDISQKYNEA 270
                       579*****************************************9999999988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.2E-12209268No hitNo description
SMARTSM003383.7E-19212276IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.254214269IPR004827Basic-leucine zipper domain
PfamPF001707.6E-13215268IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.73E-11216266No hitNo description
PROSITE patternPS000360219234IPR004827Basic-leucine zipper domain
PfamPF124987.3E-36283405IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 416 aa     Download sequence    Send to blast
MDTVFSVDEI ADQLWSSPPP MRLSHDLDSS SATSSSKMMN RSSSEWAFQR FLQEAAAAET  60
TSSSSSQQIK LNHNLIPDQS KPVSSFVSEP PIDSDEHQAF LKRRLDLACA AFALNRASYI  120
KSQDSASLPP EKGSLAANAS LCGSQLPPKG SGQELAEVQD KDAGEPIGIP PLPAVQKKPG  180
IQVRSTTSGS SGEQSEDDEA EGEAETTQST DPTDVKRVRR MLSNRESARR SRRRKQAHLT  240
ELETQVSQVR VENSSLLKRL TDISQKYNEA AVDNRVLKAD VETLRAKVKM AEETVKRVTG  300
LNPLFQAMSE ISTIMMPSFT SSPFDSSADA AVPEHDDLNY PAPENGHMPN HDCRMQNGML  360
DIPPIGNVHQ SSATEALEAN TIDRPSSMQR EASLEHLQKR ICGEASTCGN QGKGEK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1228235RRSRRRKQ
2230235SRRRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0144280.0BT014428.1 Lycopersicon esculentum clone 133746F, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015084922.10.0PREDICTED: light-inducible protein CPRF2-like isoform X1
SwissprotQ990901e-141CPRF2_PETCR; Light-inducible protein CPRF2
TrEMBLQ93YM71e-178Q93YM7_TOBAC; BZIP transcription factor
STRINGPGSC0003DMT4000500961e-177(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29342444
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28770.26e-60bZIP family protein