PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen08g004260.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ARF
Protein Properties Length: 685aa    MW: 76423.9 Da    PI: 5.7213
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen08g004260.2genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.41.4e-23133233198
                       EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                       f+kvlt sd++++g +++ +k+a+e+       +   +  ++l+ +d++g +W +k+i+r++++r++lt+GW+ Fv++++L +gD++vF ++ 
  Sopen08g004260.2 133 FCKVLTASDTSTHGGFSILRKHANEClppldmtQ--ATPAQELVAKDLHGFEWHFKHIFRGQPRRHLLTTGWSTFVSSKRLVTGDSFVFLRS- 222
                       99****************************9544..444559************************************************54. PP

                       SSEE..EEEEE- CS
                B3  87 rsefelvvkvfr 98 
                         ++e +++++r
  Sopen08g004260.2 223 -GKGEVRIGIRR 233
                       .68888999987 PP

2Auxin_resp103.72.3e-34259338183
        Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                       a+ha++t+++F v+Y+Pr+  s+F++ ++k+++a+k+++svGmRfkm+fe+e+ +e+r++Gt+vgv+d ++++W++SkWrsLk
  Sopen08g004260.2 259 ASHAVTTQTMFVVYYKPRT--SQFIIGLNKYLEAVKHQYSVGMRFKMNFEGEEIPEKRFTGTIVGVED-SSSQWKDSKWRSLK 338
                       789***************6..9**********************************************.555*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019365.1E-40121262IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.109.0E-41125248IPR015300DNA-binding pseudobarrel domain
CDDcd100171.11E-19131233No hitNo description
PfamPF023621.2E-21133233IPR003340B3 DNA binding domain
SMARTSM010193.5E-21133235IPR003340B3 DNA binding domain
PROSITE profilePS5086312.055133235IPR003340B3 DNA binding domain
PfamPF065071.2E-32259338IPR010525Auxin response factor
PfamPF023093.4E-6562616IPR033389AUX/IAA domain
SuperFamilySSF542774.58E-12574656No hitNo description
PROSITE profilePS5174524.401580661IPR000270PB1 domain
PfamPF023096.7E-6625664IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 685 aa     Download sequence    Send to blast
MENQGSFMSN QQHQQHNFSA EVSGEDELCQ ELWRLCAGPL VDVPKNEERV YYFPQGHMEQ  60
LEASTNQELN QSIPLFNLQP KILCRVLHIQ LLAEQDTDEV YAQIALLPEA DQVEPTSPDP  120
SLPEPPRPKV HFFCKVLTAS DTSTHGGFSI LRKHANECLP PLDMTQATPA QELVAKDLHG  180
FEWHFKHIFR GQPRRHLLTT GWSTFVSSKR LVTGDSFVFL RSGKGEVRIG IRRLARQPSS  240
MPQSVISSQS MHLGVLATAS HAVTTQTMFV VYYKPRTSQF IIGLNKYLEA VKHQYSVGMR  300
FKMNFEGEEI PEKRFTGTIV GVEDSSSQWK DSKWRSLKVQ WDEPASVPRP DRVSPWDIEP  360
FVASVATPLV PPMGVKNKRH RAHNEPKVSE PVPAAALAAW IPSAQFNPVI EGQSSDNPFS  420
LHTSQTNSTA TNSTFKARVD GIWSASKVNA SLNMLLDETE ASKSASPRPA FPSFASSQFG  480
KQNDLLLPSL DDERKCDTIT SCRLFGIDLK CPSFGSVNEN PPLEPANNSD GSAEGCSGNL  540
TSAGDSEDNS GLSRDSEDQK QEQLNPPPKE VHIKQVSSTR TRTKVQMQGV AVGRAVDLTK  600
LYGYDELRRE LEEMFDIQEE LHARNKWEIV FTDDEGDMML MGDYPWSEFC NIAKRIFICS  660
SQDIKSFSAG TKSPSCLESE TTAST
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1722636117355Auxin response factor 1
4ldw_A1e-1722636117355Auxin response factor 1
4ldw_B1e-1722636117355Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM5651270.0HM565127.1 Solanum lycopersicum auxin response factor 12 (ARF12) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015083562.10.0auxin response factor 18-like isoform X1
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLA0A3Q7HIF40.0A0A3Q7HIF4_SOLLC; Auxin response factor
STRINGSolyc08g008380.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23472450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61830.11e-171auxin response factor 18