PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen08g002490.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family CO-like
Protein Properties Length: 348aa    MW: 38570.8 Da    PI: 5.1512
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen08g002490.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.83.9e-071043336
          zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg 36
                      +++C+ ++  + + fC+ +  +lC +C +++H  
  Sopen08g002490.1 10 AKRCDACKATPSTVFCKADMAFLCLTCDSKIHAA 43
                      579*****************************54 PP

2zf-B_box25.13.6e-085398342
          zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                       ++C+ +e+ +++  C+ +   lC +C + +H+       H+++p+
  Sopen08g002490.1 53 VWVCEVCEHAPASVTCKADAAALCITCDQDIHSAnplarrHERIPV 98
                      689*****************************66889999999885 PP

3CCT67.73e-23284327144
               CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                       R+a++lRY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  Sopen08g002490.1 284 RKARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT 327
                       9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.855855IPR000315B-box-type zinc finger
SMARTSM003368.5E-11855IPR000315B-box-type zinc finger
CDDcd000212.47E-71255No hitNo description
PROSITE profilePS5011910.7515198IPR000315B-box-type zinc finger
PfamPF006432.2E-65398IPR000315B-box-type zinc finger
CDDcd000211.26E-75498No hitNo description
SMARTSM003363.4E-95698IPR000315B-box-type zinc finger
PROSITE profilePS5101716.708284326IPR010402CCT domain
PfamPF062032.0E-17284326IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MVAESWSTTA KRCDACKATP STVFCKADMA FLCLTCDSKI HAANKLASRH ARVWVCEVCE  60
HAPASVTCKA DAAALCITCD QDIHSANPLA RRHERIPVVP FYDSASASSS RGAAADGNDD  120
PQQHDDETEE EEAEAESWLL QAPSTNNTQG IEYKSVEYLF SDVDPYVEMD IIADQKPSND  180
IAQLHNQEEY KEDCVVPHVQ NNKNDIQLQG PVVDGYPTYE IDFSGGSKPF MYNFTTQSIS  240
QSVSSSSMEV GVVPDHNTMT DVSNTFVRNS AIDGLPNPVS SLDRKARVLR YREKRKNRKF  300
EKTIRYASRK AYAETRPRIK GRFAKRTEND VGDSLVASDA SYGVVPSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754470.0HG975447.1 Solanum pennellii chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015084938.10.0zinc finger protein CONSTANS-LIKE 4-like
SwissprotQ940T93e-96COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLA0A3Q7HHB60.0A0A3Q7HHB6_SOLLC; Uncharacterized protein
STRINGSolyc08g006530.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.12e-91CONSTANS-like 4