PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen08g002080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 351aa    MW: 38816.8 Da    PI: 5.6189
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen08g002080.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1513.2e-16180236359
                       XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 
                       ++kr rr ++NRe+ArrsR+RK+a ++ Le  v+++ +eN+aL k+l   ++++++ 
  Sopen08g002080.1 180 DIKRIRRQASNRESARRSRRRKQAHLADLESQVDQFRGENEALFKQLADATQQYKES 236
                       58******************************************9988888887765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.5E-15178242IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.6E-11180234No hitNo description
PROSITE profilePS5021711.024180235IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.62E-11181233No hitNo description
PfamPF001708.8E-14181238IPR004827Basic-leucine zipper domain
PROSITE patternPS000360185200IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MEKKMANFPS RDMKKSPSLL ALEEFVNHNK LFCGEDAKIG DVFGGNDLQQ NINNNNNNNI  60
NINHHDHDNN NSHHHAQLFD DICSIAPSFT MSNQDILSGL SNCALTEKPL WSPNITPKQS  120
SISVTGDSQS SICAGSPTPT IIMSKMRDNQ TMGANSGSYS DDDDVEGDVG PCEESADPLD  180
IKRIRRQASN RESARRSRRR KQAHLADLES QVDQFRGENE ALFKQLADAT QQYKESLTNN  240
RVLKSNVEEL RAKVKLAEVR AARGTVSSSL SHLFLNYFTP PQSLDTNNNI TMRRLDNVSP  300
AINVTGEDSW GGISGQNPMI GVENVNAFDR NINNGAMSDN ASCISEVWSF K
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1194201RRSRRRKQ
2196201SRRRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754471e-165HG975447.1 Solanum pennellii chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015083836.10.0PREDICTED: basic leucine zipper 9
TrEMBLK4CIA00.0K4CIA0_SOLLC; Uncharacterized protein
STRINGSolyc08g006110.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA81392229
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24800.11e-41basic leucine zipper 9