PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen07g033480.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRAS
Protein Properties Length: 537aa    MW: 60000.9 Da    PI: 5.3411
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen07g033480.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS447.68.1e-1371675371374
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                       l+e+L++cA+a+++++l  a++l+++l++ +s  g+p+qRl ay++e+L arla+s+s++ykal+++e +   s+e +++++l++e++P++kf
  Sopen07g033480.1 167 LKEVLIACAKAIAENNLITAEWLMSELRTVVSVCGSPIQRLGAYMLEGLVARLASSGSSIYKALRCKEPT---SVELFSYMHLLYEICPYFKF 256
                       5789*****************************************************************9...9******************* PP

              GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvak 184
                       ++l aN aI++a++ e+ +HiiDf+i qG QW++L++aLa+Rp+gpp++RiTg+++++s   +   +e +g+rL+++A++++vpfef++ v+ 
  Sopen07g033480.1 257 GYLSANGAIVDAMKDENSIHIIDFQIAQGSQWITLIHALAARPGGPPRIRITGIDDSTSAyaRGGGIEIVGRRLSSIAASCNVPFEFHP-VSA 348
                       ********************************************************998899999************************.799 PP

              GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                       ++ d+e+e+L+v+pgE laVn++l lh+++desv ++++rd++L++vkslsPk+v++veqe+++n+++F+ rfle+l+yy ++f+s+++ lpr
  Sopen07g033480.1 349 SCPDIEIEHLKVRPGEPLAVNFALVLHHMPDESVGTQNHRDRLLRMVKSLSPKIVTLVEQESNTNTAQFFPRFLETLNYYLSVFESIDVALPR 441
                       ********************************************************************************************* PP

              GRAS 278 eseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsv 370
                       +++eri+vE+++l+reivn++acegaer+erhe le+Wr+r+  aGFkp+pls+++++++k+ll+++++  y+++e++g+l+lgW++r Lv+ 
  Sopen07g033480.1 442 DHKERINVEQHCLAREIVNILACEGAERVERHELLERWRSRFALAGFKPYPLSSSVNATIKTLLENYYQS-YTLNERNGALYLGWMNRDLVAS 533
                       ********************************************************************55.********************** PP

              GRAS 371 SaWr 374
                       +aW+
  Sopen07g033480.1 534 CAWK 537
                       ***8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098569.249141518IPR005202Transcription factor GRAS
PfamPF035142.8E-134167537IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 537 aa     Download sequence    Send to blast
MRPSQNPEDI NEFNRFYNQP IEYQESYFLP SVNNPNNNQS FYADVSALKL AQHCYVESSA  60
GNSSELVSDS PPIVNFNPMM HQGSDSCRSD MHHSPDDTFQ SSGNSSCYTS DVTDLKHKLR  120
ELETAMLGPD SESLESYNTI PVTAANQVSS ESDKLVGMIE MMPSGDLKEV LIACAKAIAE  180
NNLITAEWLM SELRTVVSVC GSPIQRLGAY MLEGLVARLA SSGSSIYKAL RCKEPTSVEL  240
FSYMHLLYEI CPYFKFGYLS ANGAIVDAMK DENSIHIIDF QIAQGSQWIT LIHALAARPG  300
GPPRIRITGI DDSTSAYARG GGIEIVGRRL SSIAASCNVP FEFHPVSASC PDIEIEHLKV  360
RPGEPLAVNF ALVLHHMPDE SVGTQNHRDR LLRMVKSLSP KIVTLVEQES NTNTAQFFPR  420
FLETLNYYLS VFESIDVALP RDHKERINVE QHCLAREIVN ILACEGAERV ERHELLERWR  480
SRFALAGFKP YPLSSSVNAT IKTLLENYYQ SYTLNERNGA LYLGWMNRDL VASCAWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A2e-6817453626378Protein SCARECROW
5b3h_A2e-6817453625377Protein SCARECROW
5b3h_D2e-6817453625377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phytochrome A (phyA) signal transduction. {ECO:0000269|PubMed:10817761}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754460.0HG975446.1 Solanum pennellii chromosome ch07, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015082105.10.0scarecrow-like protein 21
RefseqXP_015082106.10.0scarecrow-like protein 21
SwissprotQ9LDL70.0PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLA0A3Q7HFS10.0A0A3Q7HFS1_SOLLC; Uncharacterized protein
STRINGSolyc07g065270.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68124111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Heyman J, et al.
    The heterodimeric transcription factor complex ERF115-PAT1 grants regeneration competence.
    Nat Plants, 2016. 2(11): p. 16165
    [PMID:27797356]