PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen07g032080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRAS
Protein Properties Length: 583aa    MW: 65004.5 Da    PI: 6.6265
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen07g032080.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS415.54.6e-1272145822373
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                        elL++cA+a+++++l   ++l+a+ +  +s +gdp+qRl ay++e+L ar   s++++y+al+++e +     + l+++++++e++P+lkf+
  Sopen07g032080.1 214 NELLIACARALAENNLDDFEKLIAKARSAVSITGDPIQRLGAYIVEGLVARKEASGTNIYRALRCKEPA---GRDLLSYMHILYEICPYLKFG 303
                       689*****************************************************************9...9******************** PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                       +++aN aI +a  +e+r+HiiDf+i qG+QW++LlqaLa+Rp+g+p +RiTg+++p s+  + + l  +g++La + e++++p+ef++ v   
  Sopen07g032080.1 304 YMAANGAIADACRNENRIHIIDFQIAQGTQWMTLLQALAARPSGAPYVRITGIDDPVSKyaRGDGLAVVGKKLAAISEKFNIPVEFHA-VPVF 395
                       ********************************************************999999**************************.6888 PP

              GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpre 278
                         +++ ++L+v+pgEalaVn+ l lh+++desv+++++rde+L++vks sPkvv++veqe+++n+++F+ rf eal+yysa+f+s++++l r+
  Sopen07g032080.1 396 APEVTRDMLNVRPGEALAVNFPLTLHHTPDESVDVTNPRDELLRMVKSFSPKVVTLVEQESNTNTAPFFPRFQEALDYYSAMFESIDVTLERD 488
                       999****************************************************************************************** PP

              GRAS 279 seerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvS 371
                        +eri+vE+++l+r+ivnv+aceg er+erhe l+kW+ r+++aGF+++pls+++++ +k+l+r ++ + y++ e++g+++lgWk+r+L+s+S
  Sopen07g032080.1 489 RKERINVEQHCLARDIVNVIACEGMERVERHELLGKWKLRFTMAGFHQYPLSSYVNSVIKSLMRCYS-EHYTLVEKDGAMLLGWKKRNLISAS 580
                       **************************************************************99888.66*********************** PP

              GRAS 372 aW 373
                       aW
  Sopen07g032080.1 581 AW 582
                       ** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.966187564IPR005202Transcription factor GRAS
PfamPF035141.6E-124214582IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 583 aa     Download sequence    Send to blast
MESHNLYGYG ATDVNLPYSY SMTTTPSIPN RLLGTLKFDS GNSPNSPFAN YNDPGTPTTL  60
SDSLEQHSST ENISGTSPCS NSSRDYNHYF CRPSPSPDFR HNNLLVYSGD NSLLQYANHS  120
HNMKHALLQL ETALMGPEEV TTSSPSAGEI QQPQASGGQR SGMWHQDGQV PYRIETQPSH  180
VSVFGISGNI IQSEKHHKPM VDYPLQGIPF GNLNELLIAC ARALAENNLD DFEKLIAKAR  240
SAVSITGDPI QRLGAYIVEG LVARKEASGT NIYRALRCKE PAGRDLLSYM HILYEICPYL  300
KFGYMAANGA IADACRNENR IHIIDFQIAQ GTQWMTLLQA LAARPSGAPY VRITGIDDPV  360
SKYARGDGLA VVGKKLAAIS EKFNIPVEFH AVPVFAPEVT RDMLNVRPGE ALAVNFPLTL  420
HHTPDESVDV TNPRDELLRM VKSFSPKVVT LVEQESNTNT APFFPRFQEA LDYYSAMFES  480
IDVTLERDRK ERINVEQHCL ARDIVNVIAC EGMERVERHE LLGKWKLRFT MAGFHQYPLS  540
SYVNSVIKSL MRCYSEHYTL VEKDGAMLLG WKKRNLISAS AWH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-632175838375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtMay play a regulatory role in the early step of oligosaccharide elicitor response, downstream of the membrane-associated high-affinity chitin-binding protein. {ECO:0000269|PubMed:12591613}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By oligosaccharide elicitor (N-Acetylchitooligosaccharide) extracted from the rice blast fungus (M.grisea) cell wall. Strongest induction by chitin oligomer with greater degree of polymerization (heptamer). By inoculation of M.grisea in rice cell suspension culture. {ECO:0000269|PubMed:12591613}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754460.0HG975446.1 Solanum pennellii chromosome ch07, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015080715.10.0scarecrow-like protein 21
SwissprotQ69VG10.0CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1
TrEMBLQ00LP60.0Q00LP6_SOLLC; GRAS2
STRINGSolyc07g063940.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA34412448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.21e-180GRAS family protein
Publications ? help Back to Top
  1. Day RB, et al.
    Two rice GRAS family genes responsive to N -acetylchitooligosaccharide elicitor are induced by phytoactive gibberellins: evidence for cross-talk between elicitor and gibberellin signaling in rice cells.
    Plant Mol. Biol., 2004. 54(2): p. 261-72
    [PMID:15159627]